BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G21 (889 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 80 4e-16 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 80.2 bits (189), Expect = 4e-16 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +2 Query: 401 GGFKGGKQVIIEPHRHPGVFIARGKEDALVTKNLVPGSEVYGEKR 535 GG KGG +VIIEPHRH GVFIARGKED LVT+NLVPG VY EKR Sbjct: 65 GGAKGGAKVIIEPHRHAGVFIARGKEDLLVTRNLVPGESVYNEKR 109 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,312,866 Number of Sequences: 5004 Number of extensions: 17749 Number of successful extensions: 40 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -