BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G16 (933 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 60 2e-11 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.64 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 1.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 1.5 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 4.5 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 60.5 bits (140), Expect = 2e-11 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +1 Query: 487 DNEIGENG-ETKKPVTYVPPEPTNDETEIFSSTISSGINFDKFDHIAVKVSGENPPRPIE 663 D + G+ G E KK Y+PPE N E ++F+S I++G+NF K D I VKV+G + P PI Sbjct: 100 DGDRGDGGGEEKKREFYIPPEVENVE-DLFTSGITTGVNFMKLDEIEVKVTGNDAPPPIT 158 Query: 664 SFE 672 SFE Sbjct: 159 SFE 161 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 25.4 bits (53), Expect = 0.64 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 166 PPPPLQNHDSVDEGHSLSRGRGFPSFNEDDEK 261 P P + H+ +RG GFP + D+++ Sbjct: 332 PRPNIDRHEVTRPAAPANRGNGFPKRSSDEQQ 363 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 478 DYEDNEIGENGETKKP 525 D ++N+ G NGE KKP Sbjct: 462 DSKNNQDGNNGEKKKP 477 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 478 DYEDNEIGENGETKKP 525 D ++N+ G NGE KKP Sbjct: 354 DSKNNQDGNNGEKKKP 369 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 4.5 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 481 YEDNEIGENGETKKPVTYVPPEP-TNDETEIFSSTISSGI 597 Y+DN +NG K PV ++ E T+ +S S G+ Sbjct: 643 YQDNVYCKNGGGKLPVRWMALESLTHQRYTTYSDVWSFGV 682 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,889 Number of Sequences: 336 Number of extensions: 2141 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26168549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -