BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G15 (951 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 36 0.039 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 34 0.12 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 33 0.21 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 33 0.21 At4g21720.1 68417.m03145 expressed protein 32 0.49 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 32 0.49 At1g26150.1 68414.m03192 protein kinase family protein similar t... 32 0.49 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 32 0.64 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 31 0.85 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 31 0.85 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 31 1.1 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 31 1.1 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 31 1.1 At1g10620.1 68414.m01204 protein kinase family protein contains ... 31 1.1 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 26 1.4 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 31 1.5 At3g24550.1 68416.m03083 protein kinase family protein contains ... 31 1.5 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 31 1.5 At1g15830.1 68414.m01900 expressed protein 31 1.5 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 31 1.5 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 30 2.0 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 30 2.0 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 30 2.0 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 30 2.0 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 30 2.0 At1g61080.1 68414.m06877 proline-rich family protein 30 2.0 At4g33660.1 68417.m04781 expressed protein 30 2.6 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 30 2.6 At1g01030.1 68414.m00003 DNA-binding protein, putative similar t... 30 2.6 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 29 3.4 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 29 3.4 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 29 3.4 At3g43583.1 68416.m04636 hypothetical protein 29 3.4 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 3.4 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 29 3.4 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 29 4.5 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 29 4.5 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 29 4.5 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 29 4.5 At2g30560.1 68415.m03722 glycine-rich protein 29 4.5 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 29 4.5 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 29 4.5 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 29 4.5 At3g55950.1 68416.m06217 protein kinase family protein contains ... 25 5.0 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 6.0 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 29 6.0 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 29 6.0 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 29 6.0 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 29 6.0 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 28 6.5 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 28 7.9 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 7.9 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 28 7.9 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 28 7.9 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 28 7.9 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 28 7.9 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 28 7.9 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 28 7.9 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 28 7.9 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 28 7.9 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 491 PTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPSG 354 P GGG P PPP G P PPPPPP RG G Sbjct: 672 PPLPGGGPPPP---PPPPGGGPPPPPGGGPPPPPPPPGALGRGAGG 714 Score = 32.3 bits (70), Expect = 0.49 Identities = 23/69 (33%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPP---PPPPRTXXPXRGPSGXXXAAIGAE 327 P P GGG + P PG P PP PPPP P P A+G Sbjct: 654 PPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPP--PPPPPPGALGRG 711 Query: 326 XGLXNR-HR 303 G N+ HR Sbjct: 712 AGGGNKVHR 720 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 512 GGXXGPXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPP 387 GG P P GGG PP PG P PPPPPP Sbjct: 676 GGGPPPPPPPPGGG--------PPPPPGGGPP----PPPPPP 705 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 491 PTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPSG 354 P R P PPP+ P P K PPPPP P P G Sbjct: 259 PPGRSAPPPPPAAAPPPQPPP-PPPPKPQPPPPPKIARPPPAPPKG 303 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -2 Query: 509 GXXGPXPTXRGGGXXPXXXNPPPRXPGRXXPXKXX-PPPPPPRTXXPXR 366 G P P P PPP P P K PPP PP+ P R Sbjct: 261 GRSAPPPPP-AAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAPKR 308 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P PPP P P PPPPPP P P Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSP 512 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P +PPP P P PPPPPP P P Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P P P +PPP P P PPPPPP P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P +PPP P P PPPPPP P Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 PPP P P PPPPPP P P Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 470 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P PPP P P PPPPPP P Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 31.5 bits (68), Expect = 0.85 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P PPP P P PPPPPP P P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P PPP P P PPPPPP P Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P +PPP P P PPPPPP P P Sbjct: 433 PPVYSPPPPPPP-PPPVYSPPPPPPPPPPPPVYSP 466 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 PPP P P PPPPPP P P Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPP 471 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P +PPP P PPPPPP P P Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPP 455 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P +PPP P P PPPPP + P Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPPPPPVYSSPP 522 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P PPP P PPPPPP P P Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPP-PPRTXXPXRGP 360 P P P PPP P P PPPP PP P P Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSP 497 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXP 372 PPP P PPPPPP + P Sbjct: 522 PPPPSPAPTPVYCTRPPPPPPHSPPP 547 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 603 TRPAXGPXPGXRXXXLAFSLGPPPPXXXPRGSXPRXXXPPXPXRXYXGAXP 755 T P P +S PPPP P S P PP P Y P Sbjct: 419 TPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 476 GGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPS 357 G P PPP P P PPPPPP P PS Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPS 412 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P PPP P P PPPPPP P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P P P P P PPPPPP P P Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P P P PPP P P PPPPP + P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P PPP P P PPP PP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P P P PPP P P P PPPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 446 PPRXPGRXXPXKXXPPPPPPRTXXPXRGPS 357 P R P P K PPPPPPR+ P + P+ Sbjct: 104 PKRPP--PPPPKPQPPPPPPRSQKPMQPPT 131 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P PPP P P + PPPPPP P Sbjct: 84 PLPRLPPPLLPPPEEPPREPPPPPPPPEEPP 114 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P PPP P R P PPPPPP P Sbjct: 89 PPPLLPPPEEPPREPP----PPPPPPEEPPP 115 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXP 372 PPP P P + PPPPPP P Sbjct: 109 PPPANPVSSPPPESSPPPPPPTEAPP 134 Score = 28.7 bits (61), Expect = 6.0 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Frame = -2 Query: 500 GPXPTXRGGGXXPXXXNPPP---RXPGRXXPXKXXPP----PPPPRTXXPXRGP 360 GP PT P PPP P P PP PPPP T P P Sbjct: 84 GPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTP 137 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 31.9 bits (69), Expect = 0.64 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPP 387 PPP P R K PPPPPP Sbjct: 643 PPPPPPTRIPAAKCAPPPPPP 663 Score = 31.9 bits (69), Expect = 0.64 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P PPP P PPPPPP + P P Sbjct: 685 PPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPP 730 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPS 357 P PPP P R P PPPP P PS Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPS 608 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPP 387 PPP R P PPPPPP Sbjct: 603 PPPPPSSRSIPSPSAPPPPPP 623 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -2 Query: 497 PXPTXRG--GGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPS 357 P P+ R P PPP G + PPPPP P R P+ Sbjct: 605 PPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPA 653 Score = 24.6 bits (51), Expect(2) = 2.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 413 KXXPPPPPPRTXXPXR 366 K PPPPPP P R Sbjct: 570 KTPPPPPPPPPPLPSR 585 Score = 23.8 bits (49), Expect(2) = 2.2 Identities = 11/28 (39%), Positives = 12/28 (42%), Gaps = 2/28 (7%) Frame = -2 Query: 464 PXXXNPPPRXPGRXX--PXKXXPPPPPP 387 P PPP P + PPPPPP Sbjct: 505 PPPPPPPPLFMSTTSFSPSQPPPPPPPP 532 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 31.5 bits (68), Expect = 0.85 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P PT + P PPP P P PPPPP T P Sbjct: 115 PPPTVKPP-PPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPP 155 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P PPP P P P PPPP+ P + P Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLP 101 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPP--PPPRTXXPXRGP 360 P PPP P P + PPP PPP P P Sbjct: 76 PPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSP 112 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPP--PPPPRTXXP 372 P +PPP P P PP PPPP+ P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = -2 Query: 476 GGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 GG P P P PPPPPP P P Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPP 77 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P P P +PPP P PPPPPP P Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSP 568 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P PPP P P PPPPP P P Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P +PPP P P PPPPP P Sbjct: 591 PPVHSPPPPAPVHSPPPPVHSPPPPPPVYSP 621 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -2 Query: 452 NPPPRXPGRXXPXKXXPPPPPPRTXXP 372 +PPP P PPPPPP P Sbjct: 517 SPPPAPVNSPPPPVYSPPPPPPPVHSP 543 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -2 Query: 491 PTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPSG 354 P GG P PPP R P + PPPP P P G Sbjct: 168 PPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPG 213 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -2 Query: 491 PTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPSG 354 P GG P PPP R P + PPPP P P G Sbjct: 168 PPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPG 213 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPSGXXXAAI 336 P PPP P P PP PP P P+G I Sbjct: 73 PPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVI 115 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/46 (28%), Positives = 14/46 (30%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P + PPP P P P PPP P P Sbjct: 52 PSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPP 97 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 446 PPRXPGRXXPXKXXPPPPPP 387 PP+ P PPPPPP Sbjct: 373 PPQYQSLIPPPSPPPPPPPP 392 Score = 23.0 bits (47), Expect(2) = 1.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 404 PPPPPPR 384 PPPPPPR Sbjct: 424 PPPPPPR 430 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 479 GGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPSG 354 G G P P P G P PPPPP P PSG Sbjct: 145 GQGGGPPGMAPIPGQGGGPPPNYNGLPPPPPYHTNPAAPPSG 186 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPP 387 PPP+ P P K PPPPPP Sbjct: 217 PPPKPPS--PPRKPPPPPPPP 235 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P PPP P P PPPPPP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPP-PPPRTXXPXRGP 360 PPP P PPP PPPR+ P + P Sbjct: 77 PPPPVTDMIKPLSSPPPPQPPPRSQPPPKPP 107 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 452 NPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 +PPP P P + PPP PP+ P R P Sbjct: 90 SPPPPQP----PPRSQPPPKPPQKNLPRRHP 116 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 446 PPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 PP P P PPPPPP P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 29.1 bits (62), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P PPP+ P + P + PPP P Sbjct: 97 PPRSQPPPKPPQKNLPRRHPPPPRSP 122 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P PP P P PPPPPP Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPP 61 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 500 GPXPTXRGGGXXPXXXN-PPPRXPGRXXPXKXXPPPP 393 G P RGGG P PPP+ G P PPP Sbjct: 121 GAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPP 157 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 500 GPXPTXRGGGXXPXXXN-PPPRXPGRXXPXKXXPPPP 393 G P RGGG P PPP+ G P PPP Sbjct: 137 GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPP 173 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 500 GPXPTXRGGGXXPXXXN-PPPRXPGRXXPXKXXPPPP 393 G P RGGG P PPP+ G P PPP Sbjct: 153 GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPP 189 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 500 GPXPTXRGGGXXPXXXN-PPPRXPGRXXPXKXXPPPP 393 G P RGGG P PPP+ G P PPP Sbjct: 169 GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPP 205 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 500 GPXPTXRGGGXXPXXXN-PPPRXPGRXXPXKXXPPPP 393 G P RGGG P PPP+ G P PPP Sbjct: 185 GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPP 221 Score = 29.5 bits (63), Expect = 3.4 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = +1 Query: 361 GPLXGXXVRGGGGGGXXFXGXXRPGXRGGGFXXXGXLPPPRXVGXG----PXXPP 513 G + G GGGG G P RGGG PPP G G P PP Sbjct: 87 GGMGGTSATRGGGGEPVIPGAPPPN-RGGGETVIPGAPPPIRGGGGEPAIPGAPP 140 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 391 GGGGGXXFXGXXRPGXRGGGFXXXGXLPPPRXVGXG----PXXPP 513 GGGG G P GGG PPP+ G G P PP Sbjct: 128 GGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPP 172 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 391 GGGGGXXFXGXXRPGXRGGGFXXXGXLPPPRXVGXG----PXXPP 513 GGGG G P GGG PPP+ G G P PP Sbjct: 144 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPP 188 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 391 GGGGGXXFXGXXRPGXRGGGFXXXGXLPPPRXVGXG----PXXPP 513 GGGG G P GGG PPP+ G G P PP Sbjct: 160 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPP 204 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 391 GGGGGXXFXGXXRPGXRGGGFXXXGXLPPPRXVGXG----PXXPP 513 GGGG G P GGG PPP+ G G P PP Sbjct: 176 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPP 220 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 391 GGGGGXXFXGXXRPGXRGGGFXXXGXLPPPRXVGXG-PXXP 510 GGGG G P GGG PPP+ G G P P Sbjct: 192 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIP 232 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 512 GGXXGPXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPP 387 GG G T RGGG P PP P R P PPP Sbjct: 87 GGMGGTSAT-RGGGGEPVIPGAPP--PNRGGGETVIPGAPPP 125 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 500 GPXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPP 393 G P RGGG PPP G P PPP Sbjct: 106 GAPPPNRGGGETVIPGAPPPIRGGGGEPAIPGAPPP 141 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPP 387 P P P +PPP P PPPPPP Sbjct: 53 PSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXPXRG 363 PPP P P PP PPP P G Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSG 398 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P+ P P + PP PPP + P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP 404 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXPXRG 363 PPP P P PP PPP P G Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSG 398 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P+ P P + PP PPP + P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPP 404 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPP 387 P P + G P PPP P K PPPPPP Sbjct: 195 PPPPYKYGRVYP----PPPPPPQAARSYKRSPPPPPP 227 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 491 PTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P RG P PPP R P PPPPP R P P Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPP-PPPPPMRRRAPLPPP 57 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 PPP P P PP PPP + P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPP--PPPRTXXPXRGPSG 354 P +PPP P P PPP PPP + P G Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTPEG 105 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXP 372 PPP P P K PPPPP P Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLP 517 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPP 387 PPP P P K PPPPP Sbjct: 458 PPPPPPPAVMPLKHFAPPPPP 478 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPR 384 P P G P PPP P PPPPPPR Sbjct: 594 PPPMPLANGATP----PPPPPPMAMANGAAGPPPPPPR 627 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPP-PRTXXPXRG 363 PPP P P K PPPP P P +G Sbjct: 476 PPPPLPPAVMPLKHFAPPPPTPPAFKPLKG 505 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 473 GXXPXXXNPPPRXPGRXXPXKXXPPPPPP 387 G P PP P + P PPPPPP Sbjct: 14 GNYPQGPPPPVGVPPQYYPPPPPPPPPPP 42 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 452 NPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPSGXXXAA 339 N PP PG PPPPP P P AA Sbjct: 370 NAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAA 407 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPP 390 P PPP P + P PPPPP Sbjct: 390 PSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/60 (30%), Positives = 21/60 (35%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPSGXXXAAIGAEXGL 318 P P + G P PPP PG+ PPPPP P + P E L Sbjct: 397 PPPPPKKGPAAP----PPPPPPGKKGAGP--PPPPPMSKKGPPKPPGNPKGPTKSGETSL 450 >At1g01030.1 68414.m00003 DNA-binding protein, putative similar to DNA-binding proteins from [Arabidopsis thaliana] RAV1 GI:3868857, RAV2 GI:3868859; contains Pfam profile PF02362: B3 DNA binding domain Length = 358 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 473 GXXPXXXNPPPRXPGRXXPXKXXPPPPPPRT 381 G P + P PGR P P PPPP T Sbjct: 249 GSEPLVIDSVPVVPGRLTPVMLPPLPPPPST 279 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P PPP P + PPPPPP P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAP 717 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 449 PPPRXPGRXXPXKXX-PPPPPPRTXXPXRGPSG 354 PPP P P PPPPPPR R +G Sbjct: 160 PPPHFPPEFPPETPTTPPPPPPRPSAASRLGNG 192 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 PPP P R PPPPPP GP Sbjct: 11 PPPPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPS 357 P P RG PP + P P PPP P + P + S Sbjct: 6 PPPHCRGFHCHRSNHRPPEKPPSPEPPPSPEPPPSPEKPTSPEQPSS 52 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 452 NPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPS 357 +PPP PG P PPPPPP G S Sbjct: 266 SPPPPPPGSWQPS---PPPPPPPVSGGMNGNS 294 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P P P PPPPPP +GP Sbjct: 27 PSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGP 61 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P PPP P P PPPPPP + P Sbjct: 403 PPLSTPPPARP---CPPVYSPPPPPPLSLAP 430 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXP 372 PPP+ P P PPPPP P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPPDP 123 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P NP P P PPPPPP Sbjct: 265 PRKSNPIPNLASEFHPSPPPPPPPPP 290 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPP--RTXXPXR 366 P P+ P +PPP PPPPPP +T P R Sbjct: 124 PPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSR 169 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 385 RGGGGGGXXFXGXXRPGXRGGGFXXXGXLPPP 480 RGGGGGG G G GGG G + P Sbjct: 25 RGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAP 56 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P P P +PPP P P PPPP + P Sbjct: 520 PPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPR 384 P PT P +P P P P K PPPP+ Sbjct: 400 PVPTRPVHKPQPPKESPQPNDPYNQSPVKFRRSPPPPQ 437 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P +PPP P PPPPP P P Sbjct: 56 PAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSP 90 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P +PPP P + PPPPP Sbjct: 105 PPIDSPPPESTNSPPPPEVFEPPPPP 130 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P +P P P P PPPPPP Sbjct: 160 PSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/41 (34%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -2 Query: 473 GXXPXXXNPPPR---XPGRXXPXKXXPPPPPPRTXXPXRGP 360 G P +PPP P P P PPPP + P P Sbjct: 144 GQPPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 25.0 bits (52), Expect(2) = 5.0 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -2 Query: 443 PRXPGRXXPXKXXPPPPPP 387 P P P PPPPPP Sbjct: 361 PASPPSQFPLPPPPPPPPP 379 Score = 22.2 bits (45), Expect(2) = 5.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 404 PPPPPPRTXXPXRGPS 357 PPPPPP + PS Sbjct: 373 PPPPPPPSPSTSSPPS 388 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = -2 Query: 509 GXXGPXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGPSG 354 G GP P G P PPP+ G+ P PP R P G G Sbjct: 169 GQGGPPPPY--GMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQG 218 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P +PPP P P PPPPP P P Sbjct: 1063 PLPQESPPPLPPLPPSPPP--PSPPLPPSSLPPPPPAALFPPLPPP 1106 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/42 (30%), Positives = 17/42 (40%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P P G P PP + G+ P + PPP P+ P Sbjct: 518 PPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPPQYPQGHPP 559 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P +PPP P P PPPP + P P Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPP 106 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P +PPP P P PPPP + P P Sbjct: 72 PPVSSPPPASPPPATPPPVASPPPPVASPPPATPP 106 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P +PPP P P PPPP P Sbjct: 713 PVTQSPPPPSPVYYPPVAKSPPPPSP 738 Score = 23.8 bits (49), Expect(2) = 6.5 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 404 PPPPPPRTXXPXRGP 360 PPPPPP T + P Sbjct: 618 PPPPPPPTYYAVQSP 632 Score = 23.0 bits (47), Expect(2) = 6.5 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPP 387 PPP+ P + P P PP Sbjct: 579 PPPKYEQTPSPREYYPSPSPP 599 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 PPPR P + PPPPPP P P Sbjct: 367 PPPRRS--PPPLQTPPPPPPPPPLAPPPPP 394 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNP-PPRX-PGRXXPXKXXPPPPPPRT 381 P P+ G P P PP+ P P PPPPP T Sbjct: 137 PSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPAT 177 >At5g13760.1 68418.m01604 expressed protein similar to unknown protein (gb AAF63775.1) Length = 569 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXP 372 PPP PPPPPPR P Sbjct: 73 PPPNLAQPLRSSSRQPPPPPPRPQTP 98 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = -2 Query: 509 GXXGPXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 G P P+ P PPP P P P PP + P GP Sbjct: 213 GPDSPLPSPGPDSPLPLP-GPPPSSSPTPGPDSPLPSPGPPPSPSPTPGP 261 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXP 372 P PT + P + PP P + PPP P ++ P Sbjct: 118 PHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPP 159 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPP 387 PPP P + PPPPPP Sbjct: 34 PPPLPPKKLLATTNTPPPPPP 54 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = -2 Query: 497 PXPTXRGGGXXPXXXNPPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 P P P NPPP PPPP T P P Sbjct: 102 PAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPP 147 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPPRTXXPXRGP 360 PPP P P + PPPPPP P P Sbjct: 230 PPPPPP---PPHQAQPPPPPPSGLFPPPPP 256 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 449 PPPRXPGRXXPXKXXPPPPPP 387 PPP P + PPPPPP Sbjct: 623 PPPLPPKKLLATTNPPPPPPP 643 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P +PPP P P PPPP P Sbjct: 547 PVTQSPPPPSPVYYPPVTQSPPPPSP 572 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P +PPP P P PPPP P Sbjct: 562 PVTQSPPPPSPVYYPPVTNSPPPPSP 587 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P +PPP P P PPPP P Sbjct: 577 PVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P +PPP P P PPPP P Sbjct: 622 PVTPSPPPPSPVYYPPVTPSPPPPSP 647 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 464 PXXXNPPPRXPGRXXPXKXXPPPPPP 387 P +PPP P P PPPP P Sbjct: 637 PVTPSPPPPSPVYYPPVTPSPPPPSP 662 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.150 0.509 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,743,531 Number of Sequences: 28952 Number of extensions: 145386 Number of successful extensions: 3105 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2297 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2285480280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -