BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G14 (855 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2260| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) 30 2.1 SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_3573| Best HMM Match : DUF1168 (HMM E-Value=1) 29 3.6 SB_17998| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 >SB_2260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 502 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 202 WNPTNGTPKWWRSRSTFHRLLWTH 273 W+P T KWW R+TF + H Sbjct: 42 WHPGRSTTKWWTRRATFITIFCVH 65 >SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) Length = 3397 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 207 PNKRYTQVVEKPFHISQAAMDTSTGDNEPCQVMVVVDGK 323 P K T+V E H + DT D+E + V VDGK Sbjct: 1711 PQKTSTEVPEPAKHFKEEIQDTHGEDDEEVEEFVEVDGK 1749 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 170 SNYQHVLGINNGTQQTVHPSGGEAVPHFTGCYGH 271 SN HVLG NG VH +G A H G +G+ Sbjct: 2301 SNGNHVLGNGNGNGNQVHSNGNHA--HSNGFHGN 2332 >SB_3573| Best HMM Match : DUF1168 (HMM E-Value=1) Length = 782 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +3 Query: 207 PNKRYTQVVEKPFHISQAAMDTSTGDNEPCQVMVVVDGK 323 P K T+V E H DT D+E + V VDGK Sbjct: 242 PQKTSTEVPEPAKHFKDEIQDTHGKDDEEVEEFVEVDGK 280 >SB_17998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1089 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 205 NPTNGTPKWWRSRSTFHRLLWTHQLVIMSHVK*WLLLMERTFSCALS 345 NP+ TPK RSR + +H L + S+ + +LL R C++S Sbjct: 145 NPSEDTPKAQRSRKSSPLHRGSHALGLCSNSRGYLLYFYRKQPCSIS 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,215,259 Number of Sequences: 59808 Number of extensions: 339514 Number of successful extensions: 750 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2431332827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -