BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G13 (915 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 44 1e-04 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 44 1e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 44 1e-04 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 42 0.001 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 41 0.001 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 41 0.002 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 41 0.002 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 39 0.006 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 38 0.009 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.011 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 36 0.035 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_29257| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 33 0.24 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 33 0.32 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 33 0.32 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.43 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 32 0.56 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 32 0.56 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 32 0.74 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 31 0.98 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 0.98 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 28 1.5 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 31 1.7 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 30 2.3 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 30 2.3 SB_4337| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 30 3.0 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 30 3.0 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 29 4.0 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_41909| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 5.2 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 5.2 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 5.2 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 5.2 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 29 5.2 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_41259| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 28 9.2 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 49.2 bits (112), Expect = 5e-06 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 4/79 (5%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXG---- 493 PPP GG P P P PP GG PP PP GG PPP G Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAP--SQPPPPGGNAPPPPPP----PGGSAPPPGGGAPPL 973 Query: 494 PPPXGGXXXFXXPPXKKXP 550 PPP GG PP P Sbjct: 974 PPPPGGSAPPPPPPPPPPP 992 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/80 (33%), Positives = 27/80 (33%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP G PPP PP PPPP G P PP PP G PP Sbjct: 914 PPGGSVPPPPPPPGGNAP-LPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPP 972 Query: 591 PXGXFXGXXPFXPXXLPPXP 650 G P P PP P Sbjct: 973 LPPPPGGSAPPPPPPPPPPP 992 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 5/82 (6%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGX-----PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXX 527 PP P GG PP G P PP PPPP G P G Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGA--- 970 Query: 528 XPPXKXPPXGGXXKXXKKXPPP 593 PP PP G PPP Sbjct: 971 -PPLPPPPGGSAPPPPPPPPPP 991 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 6/83 (7%) Frame = +2 Query: 413 PXGGXXPPXPPXKKXFXGGXXPPPXXG----PPPXGGXXXFXXPP--XKKXPXGGGXKKX 574 P GG PP PP PPP PPP GG PP P GGG Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPL 973 Query: 575 KKXPPPXGXFXXGXPXXXPXXXP 643 PPP G P P P Sbjct: 974 --PPPPGGSAPPPPPPPPPPPPP 994 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/75 (32%), Positives = 24/75 (32%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP G PP P PP G PPP PP G PPP G P Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQP--PPPGGNAPPPPPPP-----GGSAPPPGGGAPPL 973 Query: 507 GXXXXXXXPPXKXPP 551 PP PP Sbjct: 974 PPPPGGSAPPPPPPP 988 Score = 37.5 bits (83), Expect = 0.015 Identities = 24/75 (32%), Positives = 24/75 (32%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP PP P GG P PPP PP G PPP G PP Sbjct: 924 PPPGGNAPLPPPPPGGSAPSQPPPPGGNAP----PPPPPP-----GGSAPPPGGGAPPLP 974 Query: 507 GXXXXXXXPPXKXPP 551 PP PP Sbjct: 975 PPPGGSAPPPPPPPP 989 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +1 Query: 325 PPPXXKKXGXXXXPXKXXXXXXPXXXGGXPPXGXXPPPAPXKKKXXG 465 PPP G P P G PP PPP P + G Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRKLG 999 Score = 28.7 bits (61), Expect = 6.9 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 9/67 (13%) Frame = -1 Query: 561 PPPXGXFFXGGXXXXXXPPXGGG-----PXXGGGXXPPXXFFFXGGXGGXXPPXGG---- 409 PPP GG PP GG P GG PP GG PP GG Sbjct: 920 PPPPPP--PGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP-----PPGGSAPPPGGGAPP 972 Query: 408 XPPXXGG 388 PP GG Sbjct: 973 LPPPPGG 979 Score = 28.3 bits (60), Expect = 9.2 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -1 Query: 561 PPPXGXFFXGGXXXXXXPPXGGGPXXGGGXXPPXXFFFXGGXGGXXPPXGGXPP 400 PPP G G PP GG GG PP GG PP PP Sbjct: 945 PPPPG-----GNAPPPPPPPGGSAPPPGGGAPP----LPPPPGGSAPPPPPPPP 989 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 47.2 bits (107), Expect = 2e-05 Identities = 33/108 (30%), Positives = 35/108 (32%), Gaps = 10/108 (9%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXG-----GXPPXGGXXPPXPPXKKXFXGGXXPPPXX 490 PPP GG P PP G G PP G PP GG PPP Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGA 552 Query: 491 G-----PPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPPPXGXFXXGXP 619 G PPP G PP ++ PPP G G P Sbjct: 553 GQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGP 600 Score = 37.5 bits (83), Expect = 0.015 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 8/70 (11%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXG---GXPPXGGXXPPXPPXKKXFXGGXXPPPXXG- 493 PPP G P PP G G PP G PP GG PPP G Sbjct: 548 PPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQ 607 Query: 494 ----PPPXGG 511 PPP G Sbjct: 608 GWGLPPPGSG 617 Score = 35.5 bits (78), Expect = 0.060 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 7/77 (9%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXG----GXPPXGGXXPPXPPXKKXFXGGXXPP---P 484 PPP GG P P G G PP G PP G PP Sbjct: 537 PPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQ 596 Query: 485 XXGPPPXGGXXXFXXPP 535 GPPP G + PP Sbjct: 597 GGGPPPPGAGQGWGLPP 613 Score = 35.1 bits (77), Expect = 0.080 Identities = 25/75 (33%), Positives = 26/75 (34%), Gaps = 3/75 (4%) Frame = +2 Query: 404 GXPPXGGXXPPXPPXKKXFXGGXXPP---PXXGPPPXGGXXXFXXPPXKKXPXGGGXKKX 574 G P GG PP GG PP GPPP G + PP GG Sbjct: 481 GKVPGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGG----- 535 Query: 575 KKXPPPXGXFXXGXP 619 PPP G G P Sbjct: 536 ---PPPPGAGQGGGP 547 Score = 35.1 bits (77), Expect = 0.080 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 8/78 (10%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXG-----GXPPXG-GXXPPXPPXKKXFXGGXXPP-- 481 PPP GG P PP G G PP G G PP GG PP Sbjct: 526 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG-QGGPPPPGA 584 Query: 482 PXXGPPPXGGXXXFXXPP 535 GPPP G PP Sbjct: 585 GQEGPPPPGAGQGGGPPP 602 Score = 34.3 bits (75), Expect = 0.14 Identities = 36/111 (32%), Positives = 36/111 (32%) Frame = -1 Query: 657 KXXGXGXXXGXXXGXPXKKXPXGGGFFXXFFXPPPXGXFFXGGXXXXXXPPXGGGPXXGG 478 K G G G P GGG PPP G GG PP G G G Sbjct: 478 KQMGKVPGGGQGWGQPPPGAGQGGG-------PPPPGAGQGGGP-----PPPGAGQ--GW 523 Query: 477 GXXPPXXFFFXGGXGGXXPPXGGXPPXXGGXXXGXFXGXXXXPPFFXXGGG 325 G PP G GG PP G G G G PP GGG Sbjct: 524 GQPPPG-----AGQGGGPPPPGAGQ-GGGPPPPGAGQGWGQPPPGAGQGGG 568 Score = 34.3 bits (75), Expect = 0.14 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 5/77 (6%) Frame = +2 Query: 404 GXPPXGGXXPPXPPXKKXFXGGXXPPPXXG-----PPPXGGXXXFXXPPXKKXPXGGGXK 568 G PP G PP GG PPP G PPP G PP GGG Sbjct: 491 GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQG--GGPPPPGAGQGGG-- 546 Query: 569 KXKKXPPPXGXFXXGXP 619 PPP G P Sbjct: 547 ----PPPPGAGQGWGQP 559 Score = 31.1 bits (67), Expect = 1.3 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 7/80 (8%) Frame = +2 Query: 401 GGXPPXGGXXPPXPPXKKXFXGGXXPP---PXXGPPPXGGXXXFXXPPXKKXPXGG---- 559 G PP G PP GG PP G PP G PP GG Sbjct: 491 GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 550 Query: 560 GXKKXKKXPPPXGXFXXGXP 619 G + PPP G P Sbjct: 551 GAGQGWGQPPPGAGQGGGPP 570 Score = 28.3 bits (60), Expect = 9.2 Identities = 30/108 (27%), Positives = 31/108 (28%) Frame = -1 Query: 630 GXXXGXPXKKXPXGGGFFXXFFXPPPXGXFFXGGXXXXXXPPXGGGPXXGGGXXPPXXFF 451 G G P GGG PPP G G GG P G G P Sbjct: 531 GQGGGPPPPGAGQGGG-------PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPP--- 580 Query: 450 FXGGXGGXXPPXGGXPPXXGGXXXGXFXGXXXXPPFFXXGGGXFFFXF 307 G G PP G G G G PP G G + F Sbjct: 581 -PPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP----GSGLHLYCF 623 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/116 (27%), Positives = 35/116 (30%), Gaps = 8/116 (6%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXX---PPXXGGX-----PPXGGXXPPXPPXKKXFXGGXXPP 481 PPP G P + P PP G PP G PP PP + GG PP Sbjct: 207 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP-PPMRGPTSGGEPPP 265 Query: 482 PXXGPPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPPPXGXFXXGXPXXXPXXXPXP 649 P PPP PP + P PP P P P Sbjct: 266 PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPP 321 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/87 (27%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP G PP P + G PPP PP PP + PP PP Sbjct: 243 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 302 Query: 591 PXGXFXG-XXPFXPXXLPPXPXXXQXP 668 P PP P Q P Sbjct: 303 SRDQAPAPPPPLNATPPPPPPSRDQVP 329 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPPXGGXKKXXKKXPP 591 PP G PP P + GG PPP PP PP + PP PP Sbjct: 243 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 302 Score = 40.3 bits (90), Expect = 0.002 Identities = 40/162 (24%), Positives = 44/162 (27%), Gaps = 7/162 (4%) Frame = +3 Query: 348 GXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXP-----PKKKXXXGXXPPPPXGXPPXXGX 512 G PP P PP PPP KK PPPP G PP Sbjct: 120 GPALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPP---- 175 Query: 513 XXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXL--PPXPXXXQXPFWXXXX 686 P P G PPP G P P PP P + P Sbjct: 176 -----PPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLA 230 Query: 687 XXXXXXXXXXXSPXXXSXXXKNPPXXRGXTLFFXXPPXRXXP 812 +P + PP RG T PP + P Sbjct: 231 PPPTGSSRPLPAPPPGE--NRPPPPMRGPTSGGEPPPPKNAP 270 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/92 (28%), Positives = 30/92 (32%), Gaps = 1/92 (1%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPP-PXXGPPP 502 PPP + G P + PP G PP G P + G PP G P Sbjct: 147 PPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAP 206 Query: 503 XGGXXXFXXPPXKKXPXGGGXKKXKKXPPPXG 598 PP P G G + PPP G Sbjct: 207 PPPERSSGPPP---PPPGRGPSQRSLAPPPTG 235 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/89 (23%), Positives = 23/89 (25%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP + G PP P G P PP + P PP Sbjct: 196 PPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMR 255 Query: 507 GXXXXXXXPPXKXPPXGGXXKXXKKXPPP 593 G PP K P PPP Sbjct: 256 GPTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/79 (27%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +1 Query: 325 PPPXXKKXGXXXXPXKXXXXXXPXXXGGXPPXGXX--PPPAPXKK-KXXGGXXPPPPXGX 495 PPP + P P PP PPP P + + GG PPPP Sbjct: 320 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 379 Query: 496 PPXXGXXXXXXXPPKKXPP 552 PP PP P Sbjct: 380 PPSGKINPPPPPPPAMDKP 398 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/71 (29%), Positives = 23/71 (32%), Gaps = 1/71 (1%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXX-PPXPPXKKXFXGGXXPPPXXGPPP 502 PPP P + PP PP PP PP + G PPP G P Sbjct: 321 PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 380 Query: 503 XGGXXXFXXPP 535 G PP Sbjct: 381 PSGKINPPPPP 391 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 1/74 (1%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXP-PXGGXXKXXKKXP 587 PP P PP PPPP PP PP + P P GG Sbjct: 321 PPPSRDQVPLPPPPLRGQIAPPPPPISKPP-TSTRSAPPPPPGRAPQPLGGPPPPPPGRR 379 Query: 588 PPXGXFXGXXPFXP 629 PP G P P Sbjct: 380 PPSGKINPPPPPPP 393 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXP 497 PP P G P PPP PP ++ G PPP P Sbjct: 349 PPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 31.1 bits (67), Expect = 1.3 Identities = 32/129 (24%), Positives = 35/129 (27%), Gaps = 10/129 (7%) Frame = +3 Query: 312 KRKXXPPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPX----PPKKKXXXGXXPP 479 +R PP PP P G P G PPP PP K+ PP Sbjct: 226 QRSLAPPPTGSSRPLPAPPPGENRPPPPMRG--PTSGGEPPPPKNAPPPPKRGSSN--PP 281 Query: 480 PPXGXPPXXGXXXXXXXP-PXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXL-----P 641 PP P P P PPP P P L P Sbjct: 282 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 341 Query: 642 PXPXXXQXP 668 P P + P Sbjct: 342 PPPPISKPP 350 Score = 29.1 bits (62), Expect = 5.2 Identities = 32/138 (23%), Positives = 35/138 (25%), Gaps = 10/138 (7%) Frame = +3 Query: 261 KXPPXFXXXXXXXXXXXKRKXXPPXXKKXGXXXXPPXXXXXXXPXXXGGXP-PXGXXPPP 437 + PP + PP + PP G P P P Sbjct: 249 RPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAP 308 Query: 438 XPPKKKXXXGXXPPP-----PXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXG- 599 PP PPP P PP G PP PP PPP G Sbjct: 309 APPPPLNATPPPPPPSRDQVPLPPPPLRG-QIAPPPPPISKPP----TSTRSAPPPPPGR 363 Query: 600 ---XFXGXXPFXPXXLPP 644 G P P PP Sbjct: 364 APQPLGGPPPPPPGRRPP 381 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/116 (27%), Positives = 35/116 (30%), Gaps = 8/116 (6%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXX---PPXXGGX-----PPXGGXXPPXPPXKKXFXGGXXPP 481 PPP G P + P PP G PP G PP PP + GG PP Sbjct: 119 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP-PPMRGPTSGGEPPP 177 Query: 482 PXXGPPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPPPXGXFXXGXPXXXPXXXPXP 649 P PPP PP + P PP P P P Sbjct: 178 PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPP 233 Score = 42.3 bits (95), Expect = 5e-04 Identities = 24/87 (27%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP G PP P + G PPP PP PP + PP PP Sbjct: 155 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 214 Query: 591 PXGXFXG-XXPFXPXXLPPXPXXXQXP 668 P PP P Q P Sbjct: 215 SRDQAPAPPPPLNATPPPPPPSRDQVP 241 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPPXGGXKKXXKKXPP 591 PP G PP P + GG PPP PP PP + PP PP Sbjct: 155 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 214 Score = 40.3 bits (90), Expect = 0.002 Identities = 40/162 (24%), Positives = 44/162 (27%), Gaps = 7/162 (4%) Frame = +3 Query: 348 GXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXP-----PKKKXXXGXXPPPPXGXPPXXGX 512 G PP P PP PPP KK PPPP G PP Sbjct: 32 GPALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPP---- 87 Query: 513 XXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXL--PPXPXXXQXPFWXXXX 686 P P G PPP G P P PP P + P Sbjct: 88 -----PPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLA 142 Query: 687 XXXXXXXXXXXSPXXXSXXXKNPPXXRGXTLFFXXPPXRXXP 812 +P + PP RG T PP + P Sbjct: 143 PPPTGSSRPLPAPPPGE--NRPPPPMRGPTSGGEPPPPKNAP 182 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/92 (28%), Positives = 30/92 (32%), Gaps = 1/92 (1%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPP-PXXGPPP 502 PPP + G P + PP G PP G P + G PP G P Sbjct: 59 PPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAP 118 Query: 503 XGGXXXFXXPPXKKXPXGGGXKKXKKXPPPXG 598 PP P G G + PPP G Sbjct: 119 PPPERSSGPPP---PPPGRGPSQRSLAPPPTG 147 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/89 (23%), Positives = 23/89 (25%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP + G PP P G P PP + P PP Sbjct: 108 PPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMR 167 Query: 507 GXXXXXXXPPXKXPPXGGXXKXXKKXPPP 593 G PP K P PPP Sbjct: 168 GPTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/79 (27%), Positives = 25/79 (31%), Gaps = 3/79 (3%) Frame = +1 Query: 325 PPPXXKKXGXXXXPXKXXXXXXPXXXGGXPPXGXX--PPPAPXKK-KXXGGXXPPPPXGX 495 PPP + P P PP PPP P + + GG PPPP Sbjct: 232 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 291 Query: 496 PPXXGXXXXXXXPPKKXPP 552 PP PP P Sbjct: 292 PPSGKINPPPPPPPAMDKP 310 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/71 (29%), Positives = 23/71 (32%), Gaps = 1/71 (1%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXX-PPXPPXKKXFXGGXXPPPXXGPPP 502 PPP P + PP PP PP PP + G PPP G P Sbjct: 233 PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 292 Query: 503 XGGXXXFXXPP 535 G PP Sbjct: 293 PSGKINPPPPP 303 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 1/74 (1%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXP-PXGGXXKXXKKXP 587 PP P PP PPPP PP PP + P P GG Sbjct: 233 PPPSRDQVPLPPPPLRGQIAPPPPPISKPP-TSTRSAPPPPPGRAPQPLGGPPPPPPGRR 291 Query: 588 PPXGXFXGXXPFXP 629 PP G P P Sbjct: 292 PPSGKINPPPPPPP 305 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXP 497 PP P G P PPP PP ++ G PPP P Sbjct: 261 PPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 31.1 bits (67), Expect = 1.3 Identities = 32/129 (24%), Positives = 35/129 (27%), Gaps = 10/129 (7%) Frame = +3 Query: 312 KRKXXPPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPX----PPKKKXXXGXXPP 479 +R PP PP P G P G PPP PP K+ PP Sbjct: 138 QRSLAPPPTGSSRPLPAPPPGENRPPPPMRG--PTSGGEPPPPKNAPPPPKRGSSN--PP 193 Query: 480 PPXGXPPXXGXXXXXXXP-PXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXL-----P 641 PP P P P PPP P P L P Sbjct: 194 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 253 Query: 642 PXPXXXQXP 668 P P + P Sbjct: 254 PPPPISKPP 262 Score = 29.1 bits (62), Expect = 5.2 Identities = 32/138 (23%), Positives = 35/138 (25%), Gaps = 10/138 (7%) Frame = +3 Query: 261 KXPPXFXXXXXXXXXXXKRKXXPPXXKKXGXXXXPPXXXXXXXPXXXGGXP-PXGXXPPP 437 + PP + PP + PP G P P P Sbjct: 161 RPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAP 220 Query: 438 XPPKKKXXXGXXPPP-----PXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXG- 599 PP PPP P PP G PP PP PPP G Sbjct: 221 APPPPLNATPPPPPPSRDQVPLPPPPLRG-QIAPPPPPISKPP----TSTRSAPPPPPGR 275 Query: 600 ---XFXGXXPFXPXXLPP 644 G P P PP Sbjct: 276 APQPLGGPPPPPPGRRPP 293 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/80 (32%), Positives = 27/80 (33%), Gaps = 2/80 (2%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXG-GXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 PPP P PP G PP GG PP PP PPP G PP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Query: 503 XG-GXXXFXXPPXKKXPXGG 559 G PP + P G Sbjct: 387 SSLGNPPPPPPPGRGAPPPG 406 Score = 44.0 bits (99), Expect = 2e-04 Identities = 37/120 (30%), Positives = 39/120 (32%), Gaps = 12/120 (10%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXG----GXXPPXPPXKKXF------XGGXX 475 PPP G P + PP G PP G PP PP + G Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 476 PPPXXG--PPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPPPXGXFXXGXPXXXPXXXPXP 649 PPP G PPP GG PP P GG PPP G P P P Sbjct: 347 PPPSMGMAPPPVGGA---APPPPPPPPVGG--------PPPPPPPIEGRPPSSLGNPPPP 395 Score = 37.5 bits (83), Expect = 0.015 Identities = 29/108 (26%), Positives = 30/108 (27%), Gaps = 19/108 (17%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPX-----GXXPPPXPPKKKXXX--------- 464 PP G PP P G PP G PPP PP + Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 465 -----GXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPP 593 G PPP G P PP PP G PPP Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPP 394 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/83 (26%), Positives = 23/83 (27%), Gaps = 8/83 (9%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPP------- 485 PP + PP P PP G PP PP PPPP Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPS 387 Query: 486 -XGXPPXXGXXXXXXXPPXKXPP 551 G PP PP P Sbjct: 388 SLGNPPPPPPPGRGAPPPGPMIP 410 Score = 32.3 bits (70), Expect = 0.56 Identities = 25/87 (28%), Positives = 26/87 (29%), Gaps = 8/87 (9%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPX---GXXPPPXPPKKKXXXGXXPPPP-----XGXPPXXGXXX 518 PP P G PP G PPP P + G PPPP PP Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARM----GTAPPPPPPSRSSQRPPPPSRGA 345 Query: 519 XXXXPPXKXPPXGGXXKXXKKXPPPXG 599 PP G PPP G Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVG 372 Score = 30.7 bits (66), Expect = 1.7 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 9/79 (11%) Frame = +1 Query: 391 PXXXGGXPPX---GXXPPPAPXKKKXXGGXXPPPP------XGXPPXXGXXXXXXXPPKK 543 P G PP G PPP P + G PPPP PP Sbjct: 299 PPSRGAPPPPPSRGSAPPPPPARM----GTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMA 354 Query: 544 XPPXGGXKKXXKKXPPXGG 600 PP GG PP GG Sbjct: 355 PPPVGGAAPPPPPPPPVGG 373 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/86 (27%), Positives = 25/86 (29%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP PPP PP PPPP P P PP PP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP 163 Query: 591 PXGXFXGXXPFXPXXLPPXPXXXQXP 668 P P+ P PP P P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPP 189 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/115 (24%), Positives = 30/115 (26%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP PP P P PPP P PPPP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP-- 141 Query: 507 GXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXPXXXQXPF 671 PP PP PPP P+ P PP P P+ Sbjct: 142 -PSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPY 195 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/103 (27%), Positives = 29/103 (28%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXK 542 PP P PP P P PP PPPP PP PP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPP-NPPPPNAPYPPPPYPPPP 183 Query: 543 XPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXPXXXQXPF 671 PP PPP P P PP P P+ Sbjct: 184 NPPY--PPPPNPPYPPPPNAPNPPPPNPP--YPPPPNAPNPPY 222 Score = 38.3 bits (85), Expect = 0.009 Identities = 28/105 (26%), Positives = 29/105 (27%), Gaps = 3/105 (2%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPX-PPKKKXXXGXXPPPPXGX--PPXXGXXXXXXXP 533 PP P PP PPP PP PP P PP P Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYP 162 Query: 534 PXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXPXXXQXP 668 P PP PPP P+ P PP P P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPN-----PPYPPPPNPPYPPPPNAP 202 Score = 35.9 bits (79), Expect = 0.046 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 6/89 (6%) Frame = +3 Query: 402 GGXPPXGXXP------PPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGX 563 GG PP P PP PP PP P PP PP PP Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPY 140 Query: 564 XKXXKKXPPPXGXFXGXXPFXPXXLPPXP 650 PP P+ P PP P Sbjct: 141 PPSPNAPYPP----PPNPPYPPPLYPPPP 165 Score = 35.5 bits (78), Expect = 0.060 Identities = 25/103 (24%), Positives = 26/103 (25%), Gaps = 1/103 (0%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPX-PPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPX 539 PP P PP PPP PP P PP PP P Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPP 194 Query: 540 KXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXPXXXQXP 668 PP P P P+ P P P P Sbjct: 195 YPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 33.9 bits (74), Expect = 0.18 Identities = 27/104 (25%), Positives = 27/104 (25%), Gaps = 2/104 (1%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPP--XGXPPXXGXXXXXXXPP 536 PP P PP PPP P PPPP PP P Sbjct: 114 PPYPPPPNAPYPPPPNPPY--PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPN 171 Query: 537 XKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXPXXXQXP 668 PP PPP P P PP P P Sbjct: 172 APYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPX 505 PPP P P PP PP P PP P P PPP Sbjct: 168 PPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPN 227 Query: 506 GGXXXFXXPP 535 + PP Sbjct: 228 APNPPYPPPP 237 Score = 33.1 bits (72), Expect = 0.32 Identities = 27/108 (25%), Positives = 27/108 (25%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP P P PP PPP P PP P PP Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPN 200 Query: 507 GXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXP 650 PP PP PPP P P PP P Sbjct: 201 APNPPPPNPPYPPPPNA----PNPPYPPPPN-----APNPPYPPPPNP 239 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP PPP PP PPPP PP PP PP PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 591 P 593 P Sbjct: 428 P 428 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXK 542 PP P PP PPP PP PPPP PP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 543 XPP 551 PP Sbjct: 429 PPP 431 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = +3 Query: 348 GXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXX 527 G PP P PP P P PP + PPPP PP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Query: 528 XPPXKXPP 551 PP PP Sbjct: 420 PPPPPPPP 427 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP PPP PP PPPP PP PP PP PP Sbjct: 365 PPPPPPPPPPPPSPPP---PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Query: 591 P 593 P Sbjct: 422 P 422 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXK 542 PP P PP PP PP+ PPPP PP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 543 XPP 551 PP Sbjct: 426 PPP 428 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP PP PP PPPP PP PP PP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 591 P 593 P Sbjct: 429 P 429 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP PPP PP P PP PP PP PP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 591 P 593 P Sbjct: 432 P 432 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP PP P PP PPP PP PPPP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 507 GXXXXXXXPP 536 PP Sbjct: 432 PALRLACAPP 441 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXK 542 PP P PP PP PP PPPP PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 543 XPP 551 PP Sbjct: 430 PPP 432 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 PPP P P PP PP PP PP PPP PPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP P P PP PPP PP PP PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 591 P 593 P Sbjct: 430 P 430 Score = 35.9 bits (79), Expect = 0.046 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP PP PP PP P PP PP PP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 591 P 593 P Sbjct: 431 P 431 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +3 Query: 474 PPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXPX 653 PPPP PP PP PP PPP P P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 654 XXQXP 668 P Sbjct: 426 PPPPP 430 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/72 (26%), Positives = 20/72 (27%) Frame = +1 Query: 325 PPPXXKKXGXXXXPXKXXXXXXPXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPPXGXPPX 504 PPP P P PP PPP P PPPP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 505 XGXXXXXXXPPK 540 PP+ Sbjct: 431 PPALRLACAPPR 442 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +3 Query: 474 PPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXPX 653 PPPP PP PP PP PPP P P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 654 XXQXP 668 P Sbjct: 425 PPPPP 429 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 PPP P P PP PP PP PP PPP PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP----PPPPPPAPPPP 423 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +3 Query: 474 PPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXPX 653 PPPP PP PP PP PPP P P PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 654 XXQXP 668 P Sbjct: 427 PPPPP 431 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 PPP P P PP PP PP PP P P PPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPP 500 PP PP P P PPP PP PPPP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 32.7 bits (71), Expect = 0.43 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 391 PXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPP 552 P PP PPP+P PPPP PP P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 32.7 bits (71), Expect = 0.43 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 391 PXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPP 552 P PP PP P + PPPP PP PP PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = +1 Query: 325 PPPXXKKXGXXXXPXKXXXXXXPXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPPXGXPPX 504 PPP P P PP PPP P PPPP PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP----------PPPPPPPPPP 416 Query: 505 XGXXXXXXXPPKKXPP 552 PP PP Sbjct: 417 PPAPPPPPPPPPPPPP 432 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/74 (32%), Positives = 25/74 (33%) Frame = +3 Query: 429 PPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFX 608 PPP PP G P PP PP G PP P G PPP G Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP--SPQPGCAGLPPPPPPPPPGCAG 752 Query: 609 GXXPFXPXXLPPXP 650 P P +P P Sbjct: 753 LPPPPPPIDVPMKP 766 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 371 KXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXP 550 K P PP PP PP G P P PPP G PP P Sbjct: 675 KVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Query: 551 XGGGXKKXKKXPPP 592 G PPP Sbjct: 735 GCAGLPPPPPPPPP 748 Score = 38.7 bits (86), Expect = 0.006 Identities = 31/98 (31%), Positives = 31/98 (31%), Gaps = 4/98 (4%) Frame = +2 Query: 311 KKKKXPPPXXKX----GGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXP 478 K KK PPP G P P PP G P PP PP G P Sbjct: 672 KLKKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPG----CAGLPP 727 Query: 479 PPXXGPPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPPP 592 PP P P G PP P G PPP Sbjct: 728 PP---PSPQPGCAGLPPPPPPPPP---GCAGLPPPPPP 759 Score = 36.7 bits (81), Expect = 0.026 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 2/82 (2%) Frame = +3 Query: 429 PPPXPPKKKXXXG--XXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGX 602 PPP PP PPPP PP PP PP G PPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPG----CAGLPPPPPSP 732 Query: 603 FXGXXPFXPXXLPPXPXXXQXP 668 G P PP P P Sbjct: 733 QPGCAGLPPPPPPPPPGCAGLP 754 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPP 485 PP P P PPP PP G PPPP Sbjct: 718 PPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 8/66 (12%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPX--------GGXXPPXPPXKKXFXGGXXPP 481 PPP G P P PP G PP G PP PP G PP Sbjct: 699 PPPPPLLSGTLPMPPPPPPP-PPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Query: 482 PXXGPP 499 P P Sbjct: 758 PPIDVP 763 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/93 (31%), Positives = 35/93 (37%), Gaps = 17/93 (18%) Frame = +2 Query: 365 PXKXPXXXPPXXGGXPPXGGXXPP-----------XPPXKKXFXGGXXPP---PXXGPPP 502 P P PP GG PP G PP PP + + GG PP P G PP Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPP 82 Query: 503 XGGXXXFXXPPXKK---XPXGGGXKKXKKXPPP 592 G + PP + P G ++ PPP Sbjct: 83 PSG--QYGAPPTSQPYGAPPTSGYPGYQQHPPP 113 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/85 (30%), Positives = 27/85 (31%) Frame = +3 Query: 390 PXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXK 569 P GG PP PP P G PP G PP PP P GG Sbjct: 24 PAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGG--- 80 Query: 570 XXKKXPPPXGXFXGXXPFXPXXLPP 644 PPP G + P PP Sbjct: 81 -----PPPSGQYGAPPTSQPYGAPP 100 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +1 Query: 391 PXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPPXGG 561 P GG PP PPAP GG PP G PP PP P GG Sbjct: 24 PAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGG 80 Score = 37.9 bits (84), Expect = 0.011 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 1/85 (1%) Frame = +2 Query: 392 PXXGGXPPXG-GXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXGGGXK 568 P GG PP G PP P GG P G PP GG P P G Sbjct: 17 PYMGGYPPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPP-PQPGYAGGPPPPGIA 75 Query: 569 KXKKXPPPXGXFXXGXPXXXPXXXP 643 PPP G + P P P Sbjct: 76 PGIGGPPPSGQY-GAPPTSQPYGAP 99 Score = 33.5 bits (73), Expect = 0.24 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 1/85 (1%) Frame = +3 Query: 348 GXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXP-PPPXGXPPXXGXXXXX 524 G P P GG PP G P P G P P G PP G Sbjct: 49 GYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQ 108 Query: 525 XXPPXKXPPXGGXXKXXKKXPPPXG 599 PP P PPP G Sbjct: 109 QHPPPPQPSAQSY-----NAPPPAG 128 Score = 31.5 bits (68), Expect = 0.98 Identities = 22/71 (30%), Positives = 24/71 (33%), Gaps = 7/71 (9%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPXGXPP--XXGXXXXXXXPPKK-----XPPXGGXKK 570 P G PP AP G PP P G PP G PP + PP G Sbjct: 17 PYMGGYPPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAP 76 Query: 571 XXKKXPPXGGF 603 PP G + Sbjct: 77 GIGGPPPSGQY 87 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 499 GGXPXGGGGXXPXKXFFXGGXGGGXXPXGGXPPXXXG 389 GG P GG P + G G P GG PP G Sbjct: 28 GGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPG 64 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 509 PXXGGXPXGGGGXXPPXXFFFXGAGGGXXPXGG 411 P GG P G PP + A GG P GG Sbjct: 17 PYMGGYPPAAPGGYPPAPGGYPPAPGGYPPSGG 49 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/51 (31%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -2 Query: 611 PXKXPPXGGXFFXXFXX-PPXGGXFXGGXXXXXXXPXXGGXPXGGGGXXPP 462 P PP GG + PP + GG P GG P G PP Sbjct: 41 PGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPP 91 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/100 (29%), Positives = 29/100 (29%), Gaps = 4/100 (4%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXP----PPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXX 530 PP P PP P PP PP G PPPP P G Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPI 170 Query: 531 PPXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXP 650 P P PPP G G P P PP P Sbjct: 171 APAATVPAPAVPLAAASPPPPSG---GPPPPPPPPPPPPP 207 Score = 35.9 bits (79), Expect = 0.046 Identities = 29/108 (26%), Positives = 31/108 (28%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPX 505 PPP + P + P PP PP PP GG PPP P Sbjct: 110 PPPPPRA---PETPSQAPSPPPPPTS----PATRAPPPPPPIAPATGGPPPPPPIAPATG 162 Query: 506 GGXXXFXXPPXKKXPXGGGXKKXKKXPPPXGXFXXGXPXXXPXXXPXP 649 G P P PPP G G P P P P Sbjct: 163 GPPPPPPIAPAATVPAPAVPLAAASPPPPSG----GPPPPPPPPPPPP 206 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPP 485 PP P P G PP PPP PP PPPP Sbjct: 167 PPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +1 Query: 325 PPPXXKKXGXXXXPXKXXXXXXPXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPP 486 PPP P P G PP PPP P PPPP Sbjct: 166 PPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/62 (27%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +2 Query: 320 KXPPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXG-GXXPPXPPXKKXFXGGXXPPPXXGP 496 + PPP P P P G PP P PPP GP Sbjct: 136 RAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGP 195 Query: 497 PP 502 PP Sbjct: 196 PP 197 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/73 (26%), Positives = 20/73 (27%) Frame = +3 Query: 432 PPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXG 611 PP PP+ P PP PP PP P G P G Sbjct: 110 PPPPPRAPETPSQAPSPP---PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPP 166 Query: 612 XXPFXPXXLPPXP 650 P P P P Sbjct: 167 PPPIAPAATVPAP 179 Score = 28.7 bits (61), Expect = 6.9 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = +2 Query: 377 PXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXG 556 P PP P PP PP PPP PPP PP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTS---PATRAPPP---PPPIAPATGGPPPPPPIAPAT 161 Query: 557 GGXKKXKKXPPP 592 GG PPP Sbjct: 162 GG----PPPPPP 169 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/70 (31%), Positives = 24/70 (34%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP PPP PP PPPP PP P P G ++ PP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQ-QSGAPGSPAGS--PSGTSAGNPQQQPP 742 Query: 591 PXGXFXGXXP 620 P G G P Sbjct: 743 PPGQLPGQQP 752 Score = 30.7 bits (66), Expect = 1.7 Identities = 23/80 (28%), Positives = 23/80 (28%) Frame = +3 Query: 429 PPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFX 608 PPP PP PPPP PP PP PP P G Sbjct: 683 PPPPPP--------PPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSA 734 Query: 609 GXXPFXPXXLPPXPXXXQXP 668 G P PP Q P Sbjct: 735 GNPQQQPP--PPGQLPGQQP 752 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/86 (31%), Positives = 27/86 (31%) Frame = +2 Query: 410 PPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPP 589 P G P PP GG P PPP GG PP P G PP Sbjct: 431 PQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPP 490 Query: 590 PXGXFXXGXPXXXPXXXPXPXXXXXP 667 P F G P P P P P Sbjct: 491 P--PFYRGPP--PPRGMPPPPRQRMP 512 Score = 35.5 bits (78), Expect = 0.060 Identities = 28/82 (34%), Positives = 31/82 (37%), Gaps = 4/82 (4%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGX----PPXGGXXPPXPPXKKXFXGGXXPPPXXG 493 PP GG P + P PP GG PP G PP P G PP G Sbjct: 441 PPHGMPQGGG---PPQLPPNLPPPPGGMRGMPPPPMGMYPP-PRGFPPPPFGPPPPFYRG 496 Query: 494 PPPXGGXXXFXXPPXKKXPXGG 559 PPP G PP ++ P G Sbjct: 497 PPPPRG---MPPPPRQRMPSQG 515 Score = 33.9 bits (74), Expect = 0.18 Identities = 24/73 (32%), Positives = 25/73 (34%), Gaps = 5/73 (6%) Frame = +2 Query: 389 PPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXG---- 556 PP G PP G PP F G PPP PPP PP P Sbjct: 470 PPPMGMYPPPRGFPPPPFGPPPPFYRG-PPPPRGMPPPPRQRMPSQGPPQVHYPSQDPQR 528 Query: 557 -GGXKKXKKXPPP 592 G K +K PP Sbjct: 529 LGAVKAMEKGEPP 541 Score = 33.5 bits (73), Expect = 0.24 Identities = 27/96 (28%), Positives = 32/96 (33%), Gaps = 6/96 (6%) Frame = +2 Query: 320 KXPPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXG---GXXPPP-X 487 + PPP G P P P GG P PP P + G PPP Sbjct: 426 RLPPPPQHTG----PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRG 481 Query: 488 XGPPPXGGXXXF--XXPPXKKXPXGGGXKKXKKXPP 589 PPP G F PP + P + + PP Sbjct: 482 FPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 Score = 32.3 bits (70), Expect = 0.56 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 474 PPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXGXXPFXPXXLPPXPX 653 PPP PP PP P GG + PPP G G P PP Sbjct: 429 PPPQHTGPPQP-------RPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRG 481 Query: 654 XXQXPF 671 PF Sbjct: 482 FPPPPF 487 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 365 PXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPP 535 P P PP G G PP PP GG PPP PPP GG PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPP----LPGGAAPPP---PPPIGGGAPPPPPP 705 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 P G PPP PP G PPPP PP G P PP GG PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPP---PPLPG-----GAAPPPPPPIGGG-----APPP 702 Query: 591 PXGXFXG 611 P F G Sbjct: 703 PPPGFGG 709 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPX----GXPPXXGXXXXXXXPPKKXPPXGGXKKXXK 579 P G PPP P GG PPPP G P PP P GG K Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGGFANLVK 715 Score = 33.9 bits (74), Expect = 0.18 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPX 505 PPP GG P PP GG P PP PP GG PPP PP Sbjct: 662 PPPPPPPGGQAG--GAPPPPPPPLPGGAAP-----PPPPP----IGGGAPPPP---PPGF 707 Query: 506 GGXXXFXXP 532 GG P Sbjct: 708 GGFANLVKP 716 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/68 (38%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Frame = +2 Query: 392 PXXGGXPPXGGXXPPXP-PXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXGGGXK 568 P GG PP G P P + G PPP GPPP GG PP P G G Sbjct: 183 PEKGGYPPAGVGQHSGPYPGQPGMWG---PPPMGGPPPMGGPPGGYPPP--PPPPGAG-- 235 Query: 569 KXKKXPPP 592 PPP Sbjct: 236 -DPAYPPP 242 Score = 32.7 bits (71), Expect = 0.43 Identities = 23/68 (33%), Positives = 25/68 (36%) Frame = +2 Query: 329 PPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXG 508 PP P + PP GG PP GG PP GG PPP PPP Sbjct: 189 PPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGG--PP---------GGYPPPP---PPPGA 234 Query: 509 GXXXFXXP 532 G + P Sbjct: 235 GDPAYPPP 242 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +2 Query: 365 PXKXPXXXPPXXGGX--PPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGG 511 P P PP GG PP GG PP G PPP PP GG Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGG 326 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXP 497 PP P GG P PPP P PPP G P Sbjct: 283 PPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 390 PXXXGGX--PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXG 509 P GG PP G P PP G PPP PP G Sbjct: 284 PPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLG 325 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 391 PXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXG 510 P GG P PPP P G PPP PP G Sbjct: 292 PPPFGGHPAAAPPPPPLP------AGVPAPPPPPPPPMLG 325 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPX 505 PPP K P PP G PP P PP PPP GPP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSE 417 Query: 506 G 508 G Sbjct: 418 G 418 Score = 35.9 bits (79), Expect = 0.046 Identities = 22/74 (29%), Positives = 23/74 (31%) Frame = +2 Query: 377 PXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXG 556 P PP PP P PP PPP GPPP PP P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP--PPPTNGPPPPPPPTN 412 Query: 557 GGXKKXKKXPPPXG 598 G + K P G Sbjct: 413 GPPSEGKCGRKPAG 426 Score = 35.1 bits (77), Expect = 0.080 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 PPP P PP PP P PP PPP GPPP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP PPP PP K PPPP P PP P G P Sbjct: 359 PPTNNTPPPPPPTNKPP----PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Query: 591 PXGXFXGXXP 620 P G P Sbjct: 415 PSEGKCGRKP 424 Score = 32.3 bits (70), Expect = 0.56 Identities = 23/73 (31%), Positives = 23/73 (31%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP P P PP PPPP PP PP PP G PP Sbjct: 349 PPTNNPPSPPPPTNNTPP---PPPPTNKPPP--PPPPTNGPPPPPPPTNG-------PPP 396 Query: 591 PXGXFXGXXPFXP 629 P G P P Sbjct: 397 PPPPTNGPPPPPP 409 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/79 (26%), Positives = 21/79 (26%) Frame = +1 Query: 325 PPPXXKKXGXXXXPXKXXXXXXPXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPPXGXPPX 504 PPP P P PP P P G PPPP PP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP- 405 Query: 505 XGXXXXXXXPPKKXPPXGG 561 PP PP G Sbjct: 406 ------PPPPPTNGPPSEG 418 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/77 (25%), Positives = 21/77 (27%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPPXGGXKKXXKKXPP 591 PP PPP P G PPPP P PP P G + P Sbjct: 369 PPTNKPPPPPPPTN----GPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGKCGRKP 424 Query: 592 XGGFFXGXXXXXPXXXP 642 G P P Sbjct: 425 AGARIINGQNAQPHSWP 441 Score = 28.7 bits (61), Expect = 6.9 Identities = 24/82 (29%), Positives = 24/82 (29%) Frame = +3 Query: 405 GXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKX 584 G G PP PP PPP PP PP PP G Sbjct: 337 GTSGGGGVNPPPPPTNNPP--SPPPPTNNTPP---PPPPTNKPPPPPPPTNG-------P 384 Query: 585 PPPXGXFXGXXPFXPXXLPPXP 650 PPP G P P P P Sbjct: 385 PPPPPPTNGPPPPPPPTNGPPP 406 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/68 (29%), Positives = 22/68 (32%) Frame = +3 Query: 390 PXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXK 569 P GG PP PPP PP PP P G P + PP Sbjct: 282 PMPPGGMPPNMEQPPPPPPSSGVSNSGMMPPHMQNPQHMGHQMMPGMMPQQFPPNLMWGM 341 Query: 570 XXKKXPPP 593 + PPP Sbjct: 342 TGQTRPPP 349 Score = 36.3 bits (80), Expect = 0.035 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = +2 Query: 329 PPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPP-PX 505 PP G P PP G PP G PP P G PPP PP P Sbjct: 228 PPVGMLGHPPMGAPPPPHSMPPP--GMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Query: 506 GGXXXFXXPPXKKXPXGG 559 GG P P G Sbjct: 286 GGMPPNMEQPPPPPPSSG 303 Score = 35.9 bits (79), Expect = 0.046 Identities = 26/91 (28%), Positives = 28/91 (30%), Gaps = 2/91 (2%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP P P PP PP PP G PPP G PP Sbjct: 215 PPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPP-----PGMMPPP--GFPPMG 267 Query: 507 GXXXXXXXPPXKXP--PXGGXXKXXKKXPPP 593 PP P P GG ++ PPP Sbjct: 268 MPGMGGMPPPGMPPPMPPGGMPPNMEQPPPP 298 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +1 Query: 406 GXPPXGXXPPPA-PXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPPXGGXKKXXKK 582 G PP G PPP P G PPP P G P PP G Sbjct: 251 GMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPSSGVSNSGMM 310 Query: 583 XP 588 P Sbjct: 311 PP 312 Score = 30.3 bits (65), Expect = 2.3 Identities = 24/90 (26%), Positives = 27/90 (30%), Gaps = 2/90 (2%) Frame = +2 Query: 329 PPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXG 508 PP G P P PP GG PP PP PP PP P Sbjct: 264 PPMGMPGMGGMPPPGMPPPMPP--GGMPP-NMEQPPPPPPSSGVSNSGMMPPHMQNPQHM 320 Query: 509 GXXXFXXPPXKKXPXG--GGXKKXKKXPPP 592 G ++ P G + PPP Sbjct: 321 GHQMMPGMMPQQFPPNLMWGMTGQTRPPPP 350 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 36.7 bits (81), Expect = 0.026 Identities = 27/93 (29%), Positives = 30/93 (32%), Gaps = 4/93 (4%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXP-PPXXGPPP 502 PPP P PP G PP G P PP GG P PP GPP Sbjct: 350 PPPWATSNSGPKPLMSTPVQRPP--GMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPM 407 Query: 503 XG---GXXXFXXPPXKKXPXGGGXKKXKKXPPP 592 + P P G + + PPP Sbjct: 408 LNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPP 440 Score = 31.9 bits (69), Expect = 0.74 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 6/63 (9%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXG---GXPPXG---GXXPPXPPXKKXFXGGXXPPPX 487 PPP K GG P P PP PP G PP PP F PPP Sbjct: 387 PPPWSKPGGILPGP---PPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPS 443 Query: 488 XGP 496 P Sbjct: 444 DAP 446 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPP 537 PP PAP GG PPPP PP G PP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 35.1 bits (77), Expect = 0.080 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +2 Query: 329 PPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXG-GXXPPPXXGPPP 502 P GG P P PP GG PP PP G G PPP PPP Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP--PPP 337 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPP 536 PP P PP G PPPP PP G PP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 410 PPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPP 535 PP G P PP GG PPP PPP G PP Sbjct: 295 PPADGSAPAPPPPPPP--GGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPP 536 P G P P PP PPPP PP G PP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.5 bits (68), Expect = 0.98 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPP 445 PPP GG P P PP GG PP PP PP Sbjct: 304 PPPPPPPGG-APPPPPPPPPPPPGDGGAPP-----PPPPP 337 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPP 537 P G P P P PPPP PP G PP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 36.3 bits (80), Expect = 0.035 Identities = 23/86 (26%), Positives = 27/86 (31%), Gaps = 1/86 (1%) Frame = +3 Query: 414 PXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKX-PPXGGXXKXXKKXPP 590 P G P PPK+K P P P PP K PP ++ PP Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Query: 591 PXGXFXGXXPFXPXXLPPXPXXXQXP 668 P P P +P P P Sbjct: 1079 PSTSQPVPPPRQPDPIPTNPAHPTEP 1104 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/82 (25%), Positives = 23/82 (28%), Gaps = 2/82 (2%) Frame = +3 Query: 312 KRKXXPPXXKKXGXXXXP--PXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPP 485 KRK PP + P P P PP PPP P PPP Sbjct: 1030 KRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPR 1089 Query: 486 XGXPPXXGXXXXXXXPPXKXPP 551 P PP + P Sbjct: 1090 QPDPIPTNPAHPTEPPPRQPKP 1111 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/58 (32%), Positives = 21/58 (36%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPP 499 PPP G P P PP G PP P PP + + PPP PP Sbjct: 154 PPPQTTMG----YPSAQPGFAPP--GNYPPPPAPPPAYPPVTQGYNMSQYPPPDVAPP 205 >SB_29257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 494 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +3 Query: 432 PPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXG 611 PP PP+ PPP PP P PP K P G Sbjct: 421 PPLPPRHPLRVSPTTPPPL--PPRSSHPSIELKPSIPLPPRFANVNDVKSSAPKNGPEEC 478 Query: 612 XXPFXPXXLPP 644 P P LPP Sbjct: 479 APPALPPALPP 489 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 33.5 bits (73), Expect = 0.24 Identities = 22/77 (28%), Positives = 24/77 (31%) Frame = +1 Query: 328 PPXXKKXGXXXXPXKXXXXXXPXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXX 507 PP G P GG PP P P P + G P PP P Sbjct: 126 PPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQP 185 Query: 508 GXXXXXXXPPKKXPPXG 558 G PP+ PP G Sbjct: 186 G------YPPQGYPPTG 196 Score = 33.1 bits (72), Expect = 0.32 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP G P GG PP P P P + G P PP P Sbjct: 126 PPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQP 185 Query: 507 GXXXXXXXPPXKXPPXG 557 G PP PP G Sbjct: 186 G------YPPQGYPPTG 196 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 33.1 bits (72), Expect = 0.32 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 392 PXXGGXPPX---GGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 P GG PP GG PP PP GG P P PPP Sbjct: 647 PFFGGIPPPPPGGGMFPPPPPPPP---GGGVPGPPKPPPP 683 Score = 32.3 bits (70), Expect = 0.56 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 476 PPPXXG--PPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPPP 592 P P G PPP G F PP P GGG K PPP Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPP--PPGGGVPGPPKPPPP 683 Score = 31.9 bits (69), Expect = 0.74 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 413 PXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPP 535 P G PP PP GG PPP PPP GG PP Sbjct: 647 PFFGGIPPPPPG-----GGMFPPPPP-PPPGGGVPGPPKPP 681 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +3 Query: 402 GGXPPX----GXXPPPXPPKKKXXXGXXPPPPXGXPP 500 GG PP G PPP PP G P PP PP Sbjct: 650 GGIPPPPPGGGMFPPPPPPPP---GGGVPGPPKPPPP 683 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 33.1 bits (72), Expect = 0.32 Identities = 23/78 (29%), Positives = 26/78 (33%) Frame = -3 Query: 643 GGXXXGXXGXXPXKXPXGGGXFFXFFXXPPXGGFFXGGXXKXXXXPXXGGXPXGGGGXXP 464 GG G G + GGG + GG GG GG GG G Sbjct: 151 GGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGG 210 Query: 463 XKXFFXGGXGGGXXPXGG 410 + GG GGG GG Sbjct: 211 GGGYGGGGYGGGRSGGGG 228 Score = 29.9 bits (64), Expect = 3.0 Identities = 27/96 (28%), Positives = 31/96 (32%) Frame = -3 Query: 649 GXGGXXXGXXGXXPXKXPXGGGXFFXFFXXPPXGGFFXGGXXKXXXXPXXGGXPXGGGGX 470 G GG G G GGG + GG+ GG GG GGG Sbjct: 123 GGGGRRGGGYGGGRG----GGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGY---GGGG 175 Query: 469 XPXKXFFXGGXGGGXXPXGGXPPXXXGXXXXXFXGG 362 + GG GGG GG G + GG Sbjct: 176 YGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGG 211 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 32.7 bits (71), Expect = 0.43 Identities = 25/82 (30%), Positives = 28/82 (34%), Gaps = 2/82 (2%) Frame = +3 Query: 405 GXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKX 584 G PP G PPP PP G PP PP PP G ++ Sbjct: 222 GMPPGG--PPPFPPTSDPNMGHH--PPISGPPTTSMSGPPIPVHHGMPPQYG---PGRRD 274 Query: 585 PPPXGXFXGXXP--FXPXXLPP 644 PP G G P P +PP Sbjct: 275 MPPPGAPPGMLPPGMPPHGMPP 296 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXG---XXPPPPXGXPP 500 P G PPP PP G PPPP G PP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 31.9 bits (69), Expect = 0.74 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 391 PXXXGGXPPXGXXPPPAPXKKKXXGGXXPPPP--XGXPP 501 P G PP PPP P GG PPPP G PP Sbjct: 188 PSPMAGMPP----PPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 377 PXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 P PP G P GG PP PP G PP G PP Sbjct: 196 PPPPPPPPPGFP--GGAPPPPPPP----FGAPPPPALNGGPP 231 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 32.3 bits (70), Expect = 0.56 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +3 Query: 402 GGXPPXGXXPP-PXPPKKKXXXGXXPPPPXGXP-PXXGXXXXXXXP---PXKXPPXGG 560 GG P G PP P P PP P G P P G P P PP GG Sbjct: 16 GGMPRPGAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGG 73 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 32.3 bits (70), Expect = 0.56 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Frame = +2 Query: 392 PXXGGXP-PXGGXXPPXPPXKKXFXGGXXPP---PXXGPPPXGGXXXFXXPP 535 P G P P G PP P K + G PP GPP GG + PP Sbjct: 1063 PGADGVPGPKGPPGPPGYPGFKGYRGPQGPPGIAGEPGPPGIGGGIGYMGPP 1114 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 32.3 bits (70), Expect = 0.56 Identities = 24/72 (33%), Positives = 26/72 (36%) Frame = +3 Query: 429 PPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFX 608 PPP PP+ PPPP PP PP PP K + PPP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPP------RPPPPPPPSPPRPLAAKLPE--PPP----- 250 Query: 609 GXXPFXPXXLPP 644 P P LPP Sbjct: 251 --IPNMPPTLPP 260 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPP 551 PP PPP PP PPPP PP PP P Sbjct: 211 PPPSPPPPPPPPSPSPP--RPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 414 PXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPP 551 P PPP PP PPPP P P PP Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPP 500 PP PPP PP PP P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPP 500 PP P P PPP PP+ PPP PP Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +2 Query: 365 PXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 P P PP PP PP P + PPP PP Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 31.9 bits (69), Expect = 0.74 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +2 Query: 341 KXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPP--XPPXKKXFXGGXXPPPXXGPPP 502 + GG P + P P G P G PP PP G PP GPPP Sbjct: 66 RRGGYGGGPPRGPPRGHPMRGRGAPYGRGGPPSRGPPRGPPLPG----PPRRGPPP 117 Score = 29.1 bits (62), Expect = 5.2 Identities = 23/83 (27%), Positives = 24/83 (28%) Frame = +3 Query: 420 GXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXG 599 G PP PP+ G P G PP G PP PP G G Sbjct: 71 GGGPPRGPPRGHPMRGRGAPYGRGGPPSRG---PPRGPPLPGPPRRGPPPDRDSGYGGYG 127 Query: 600 XFXGXXPFXPXXLPPXPXXXQXP 668 P P PP P P Sbjct: 128 DRYDRPP--PDRRPPPPDRSGYP 148 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 31.9 bits (69), Expect = 0.74 Identities = 23/83 (27%), Positives = 25/83 (30%), Gaps = 3/83 (3%) Frame = +3 Query: 411 PPXGXXPPPXPPKK--KXXXGXXPPPPXGX-PPXXGXXXXXXXPPXKXPPXGGXXKXXKK 581 PP G P P P G PPP G PP PP P + Sbjct: 175 PPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQG 234 Query: 582 XPPPXGXFXGXXPFXPXXLPPXP 650 PP G + G P P P Sbjct: 235 YAPPPGGYPGAPPAGGYPGAPPP 257 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/67 (32%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = -1 Query: 612 PXKKXPXGGGFFXXFFXPPPXGXFFXGGXXXXXXPPXGG--GPXXGGGXXPPXXFFFXGG 439 P P G G + + PPP G + G PP GG P GG PP + Sbjct: 158 PPGTQPPGQGGYPGYNQPPP-GHYPAPGQPGGYYPPPGGYQQPPPGGYAPPP----YVPQ 212 Query: 438 XGGXXPP 418 GG PP Sbjct: 213 EGGGIPP 219 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 476 PPPXXGPPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPPPXG 598 PPP PP GG + PP P G + PPP G Sbjct: 157 PPPGTQPPGQGGYPGYNQPPPGHYPAPG--QPGGYYPPPGG 195 Score = 29.5 bits (63), Expect = 4.0 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 377 PXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPP-XXGPPPXGGXXXFXXPPXKKXPX 553 P PP GG P P P GG PPP PP GG + PP Sbjct: 159 PGTQPPGQGGYPGYNQPPPGHYPAPGQ-PGGYYPPPGGYQQPPPGG---YAPPPYVPQEG 214 Query: 554 GG 559 GG Sbjct: 215 GG 216 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 507 PXGGGPXXGGGXXPPXXFFFXGGXGGXXPPXGG--XPPXXG 391 P G G G PP + G GG PP GG PP G Sbjct: 163 PPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGG 203 Score = 28.7 bits (61), Expect = 6.9 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 8/78 (10%) Frame = +3 Query: 411 PPXGXXPPPX--------PPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXX 566 PP G PPP PP+ PPP G P G PP GG Sbjct: 200 PPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPPPGGYPG-------APPAGG-- 250 Query: 567 KXXKKXPPPXGXFXGXXP 620 PPP G G P Sbjct: 251 --YPGAPPPGGYPGGPPP 266 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +3 Query: 429 PPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFX 608 PPP PP PPPP P PP PP PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAP---AAPPPPAAPPAAPPP---PPPLPAPPPPPAQPAP 103 Query: 609 GXXPFXPXXLP 641 P P LP Sbjct: 104 QPPPAPPHFLP 114 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/58 (25%), Positives = 15/58 (25%) Frame = +3 Query: 363 PPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPP 536 PP PP P PP PPPP PP PP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 31.5 bits (68), Expect = 0.98 Identities = 25/86 (29%), Positives = 26/86 (30%) Frame = -3 Query: 667 GXXXXXGXGGXXXGXXGXXPXKXPXGGGXFFXFFXXPPXGGFFXGGXXKXXXXPXXGGXP 488 G G GG G G GGG GG+ GG G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG 848 Query: 487 XGGGGXXPXKXFFXGGXGGGXXPXGG 410 GGGG GG GGG GG Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 28.3 bits (60), Expect = 9.2 Identities = 24/86 (27%), Positives = 25/86 (29%) Frame = -3 Query: 667 GXXXXXGXGGXXXGXXGXXPXKXPXGGGXFFXFFXXPPXGGFFXGGXXKXXXXPXXGGXP 488 G G GG G G G G + GG GG GG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGF 836 Query: 487 XGGGGXXPXKXFFXGGXGGGXXPXGG 410 GGG GG GGG GG Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGG 862 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 405 GXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPP 500 G P PPP PP PPPP PP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXP 497 PP PPP PP PPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.5 bits (68), Expect = 0.98 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPP 551 PP PP PPK PPPP G P PP PP Sbjct: 1236 PPPPAMPPDGPPKFMGL----PPPPPGMRPMPPQPPFMPPPPRMQPP 1278 Score = 29.9 bits (64), Expect = 3.0 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +2 Query: 410 PPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPP 589 PP PP P K F G PPP G P F PP + P G P Sbjct: 1235 PPPPPAMPPDGPPK--FMG--LPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQ 1290 Query: 590 P 592 P Sbjct: 1291 P 1291 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPP 552 PP PP P K PPPP G P PP+ PP Sbjct: 1236 PPPPAMPPDGPPKFMGL----PPPPPGMRPMPPQPPFMPPPPRMQPP 1278 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGG--XPPXGXXP-PPXPPKKKXXXGXXPPPPXGXP 497 PP PP P G PP G P PP PP PP P G P Sbjct: 1225 PPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Query: 498 PXXG 509 G Sbjct: 1285 GPPG 1288 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +3 Query: 390 PXXXGGXPPXGXXPPPXPPKKKXXXGXXPPP--PXGXPPXXGXXXXXXXPPXKXPP 551 P G P G P PP+ G PP P G PP G P PP Sbjct: 388 PKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPP 443 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +1 Query: 406 GXPPXGXXPPP--APXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPPXGGXKKXXK 579 G PP G P P + G PP P G P G PP P G Sbjct: 380 GFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGP 439 Query: 580 KXPP 591 PP Sbjct: 440 GMPP 443 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +3 Query: 405 GXPPXGXXPPPX--PPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXK 578 G PP G P P + G PP P G P G PP P G Sbjct: 380 GFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGP 439 Query: 579 KXPP 590 PP Sbjct: 440 GMPP 443 Score = 28.7 bits (61), Expect = 6.9 Identities = 19/68 (27%), Positives = 20/68 (29%), Gaps = 2/68 (2%) Frame = +3 Query: 432 PPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP--PXGXF 605 P PP+ P P G P G P PP G PP P G Sbjct: 379 PGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPG 438 Query: 606 XGXXPFXP 629 G P P Sbjct: 439 PGMPPMRP 446 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = +2 Query: 404 GXPPXGGXXPPXPPXKKXFXGGXXPPPXXG-PPPXGGXXXF--XXPPXKKXP 550 G PP G P PP + F PPP PPP F PP + P Sbjct: 277 GFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPP 328 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 31.1 bits (67), Expect = 1.3 Identities = 27/97 (27%), Positives = 29/97 (29%), Gaps = 6/97 (6%) Frame = +3 Query: 348 GXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXP----PKKKXXXGXXP--PPPXGXPPXXG 509 G P P P G PPP P P+ G P PPP G P Sbjct: 566 GQTYVPDHRTTGGYPAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYP---- 621 Query: 510 XXXXXXXPPXKXPPXGGXXKXXKKXPPPXGXFXGXXP 620 PP GG PPP G + G P Sbjct: 622 ---GGYPGTHTAPPAGGYPTGQHPPPPPAG-YPGYGP 654 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 28.3 bits (60), Expect = 9.2 Identities = 23/96 (23%), Positives = 23/96 (23%), Gaps = 7/96 (7%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXP-PXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 PP P K P G P PP PP P P PPP Sbjct: 364 PPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPP 423 Query: 503 ------XGGXXXFXXPPXKKXPXGGGXKKXKKXPPP 592 G PP G PPP Sbjct: 424 SVFAPSSGVPTPVAAPPPSVFASSSGVPTPVTAPPP 459 Score = 27.5 bits (58), Expect(2) = 1.5 Identities = 17/63 (26%), Positives = 17/63 (26%), Gaps = 1/63 (1%) Frame = +2 Query: 317 KKXPPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXP-PXPPXKKXFXGGXXPPPXXG 493 K PP P P PP P G P PP P P Sbjct: 379 KAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAA 438 Query: 494 PPP 502 PPP Sbjct: 439 PPP 441 Score = 21.8 bits (44), Expect(2) = 1.5 Identities = 11/39 (28%), Positives = 11/39 (28%) Frame = +2 Query: 476 PPPXXGPPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPPP 592 PPP P G PP G PPP Sbjct: 461 PPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPP 499 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 377 PXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPP 535 P PP PP G P PP G P G P G F PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPP 81 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +3 Query: 390 PXXXGGXP-PXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPP 551 P G P P G PP PP G PP PP G P K PP Sbjct: 257 PQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPP--GPPGLPGAPGPKGPP 309 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 431 PPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPP 589 PP PP + PPP GPP G F P P G PP Sbjct: 30 PPPPPYEA-------PPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +2 Query: 389 PPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXG 556 P G P G PP P G PP GPP G PP + P G Sbjct: 613 PGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP---LGPPGESGPAG 665 Score = 29.1 bits (62), Expect = 5.2 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +2 Query: 389 PPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXGG-GX 565 P G P G PP P G PP GPP G PP P G G Sbjct: 868 PGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGC---LGPPGDAGPAGNTGG 924 Query: 566 KKXKKXPP 589 + PP Sbjct: 925 AGCQPAPP 932 Score = 28.7 bits (61), Expect = 6.9 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 3/79 (3%) Frame = +2 Query: 329 PPXXKXG--GXXXXPXKXPXXXPPXX-GGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPP 499 PP G G P PP G P G PP P G PP GPP Sbjct: 80 PPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Query: 500 PXGGXXXFXXPPXKKXPXG 556 G PP P G Sbjct: 140 GTNGE---LGPPGDVGPPG 155 Score = 28.7 bits (61), Expect = 6.9 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 4/79 (5%) Frame = +2 Query: 332 PXXKXGGXXXXPXKXPXXXPPXXGGXP-PXGGXXPPXPPXKKXFXGGXXPP---PXXGPP 499 P GG P G P P G PP PP G PP GPP Sbjct: 238 PPGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPP 297 Query: 500 PXGGXXXFXXPPXKKXPXG 556 G PP P G Sbjct: 298 GLPGAPGPKGPPGTNGPLG 316 Score = 28.3 bits (60), Expect = 9.2 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 7/69 (10%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXP-------PXGGXXPPXPPXKKXFXGGXXPPP 484 PP G P + PP G P P G PP P G PP Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPG 149 Query: 485 XXGPPPXGG 511 GPP G Sbjct: 150 DVGPPGNPG 158 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 30.7 bits (66), Expect = 1.7 Identities = 31/115 (26%), Positives = 32/115 (27%), Gaps = 1/115 (0%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPX 505 PPP + G P P G PP G P PP G PP Sbjct: 2124 PPPMGQYGAPAR-PAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPS 2182 Query: 506 GGXXXFXXPPXKKXPXGGGXKKXKKXPPPXGXFXXG-XPXXXPXXXPXPXXXXXP 667 G PP P G PPP G G P P P P P Sbjct: 2183 G-------PPPMGAPPSG--------PPPMGTPPSGHPPMGAPPMGPPPSGSHSP 2222 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/59 (30%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +2 Query: 332 PXXKXGGXXXXPXKXPXXX--PPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 P + G P + P PP G PP PP P + + G PP G PP Sbjct: 339 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPG-RPPHEPGRPP 396 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +2 Query: 332 PXXKXGGXXXXPXKXPXXX--PPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 P + G P + P PP G PP PP P + G PP G PP Sbjct: 346 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPG-RPPHELGRPP 403 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +2 Query: 332 PXXKXGGXXXXPXKXPXXX--PPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 P + G P + P PP G PP PP P + G PP G PP Sbjct: 332 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPG-RPPYEPGRPP 389 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPP 500 PP PPP PP PPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/59 (30%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +2 Query: 332 PXXKXGGXXXXPXKXPXXX--PPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 P + G P + P PP G PP PP P + + G PP G PP Sbjct: 105 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPG-RPPHEPGRPP 162 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +2 Query: 332 PXXKXGGXXXXPXKXPXXX--PPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 P + G P + P PP G PP PP P + G PP G PP Sbjct: 112 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPG-RPPHELGRPP 169 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +2 Query: 332 PXXKXGGXXXXPXKXPXXX--PPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPP 502 P + G P + P PP G PP PP P + G PP G PP Sbjct: 98 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPG-RPPYEPGRPP 155 >SB_4337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 30.3 bits (65), Expect = 2.3 Identities = 30/102 (29%), Positives = 38/102 (37%), Gaps = 4/102 (3%) Frame = +2 Query: 326 PPPXXKXGGXXXXPXKXPXXXPPXXGGX-PPXGGXXPPXPPXKKXFXGGXXPPPX---XG 493 PPP + G P + PP G PP G PP ++ G PPP G Sbjct: 243 PPPGQQ--GYGPPPGQQGYGAPPGQQGYGPPLGQQGYGPPPGQQ----GYGPPPGQQGYG 296 Query: 494 PPPXGGXXXFXXPPXKKXPXGGGXKKXKKXPPPXGXFXXGXP 619 PPP G + PP ++ G + PP G G P Sbjct: 297 PPP--GQQGYGSPPGQQ--GYGPPPGQQGYGPPAGQQGYGPP 334 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPP--PXGXPPXXGXXXXXXXPPKKXPPXGG 561 PP PP AP PPP P P PP PP GG Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPPVGG 212 Score = 29.5 bits (63), Expect = 4.0 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +2 Query: 365 PXKXPXXXPPXXGGXPPXGGXX-PPXPPXKKXFXGGXX-PPPXXGPPPXGG 511 P P P PP G PP PP F G PPP PP GG Sbjct: 167 PPAAPFMAPAAPPAPPPPGAPAAPPAPP----FGGPPSAPPPPPAPPVGGG 213 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.9 bits (64), Expect = 3.0 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPP 590 PP PP P PPPP PP P PP PP Sbjct: 290 PPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPP---------PPPP 340 Query: 591 PXGXFXGXXPFXPXXLPP 644 P F P PP Sbjct: 341 PSEDFYSMPSSLPMPSPP 358 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/75 (24%), Positives = 19/75 (25%) Frame = +3 Query: 327 PPXXKKXGXXXXPPXXXXXXXPXXXGGXPPXGXXPPPXPPKKKXXXGXXPPPPXGXPPXX 506 PP PP P PP PPP PP + P PP Sbjct: 301 PPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSPPED 360 Query: 507 GXXXXXXXPPXKXPP 551 P PP Sbjct: 361 LYDAPATLPSPIMPP 375 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPP 485 PP PPP PP+ PPPP Sbjct: 305 PPTDFAPPPPPPEPTSELPPPPPPP 329 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 29.5 bits (63), Expect = 4.0 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = -3 Query: 586 GXFFXFFXXPPXGGFFXGGXXKXXXXPXXGGXPXGGGGXXPXKXFFXGGXGGGXXPXG 413 G F F P G GG P GG G + GG GGG P G Sbjct: 322 GIQFDFVNTEPKGDSRGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQG 379 >SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) Length = 792 Score = 29.5 bits (63), Expect = 4.0 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +1 Query: 391 PXXXGGXPPXGXXPPP---APXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPP 552 P GG P PP P + G P PP G PP G P+ PP Sbjct: 239 PMGHGGPPMDRGGPPMMHGGPGPRMPHSGPEPVPPGG-PPMQGGPNMRGPHPRMDPP 294 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPXGXPP 501 PP P PAP PPPP PP Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPP 386 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.1 bits (62), Expect = 5.2 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +3 Query: 414 PXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPP 593 P PP PP G PPP P PP PP G PP Sbjct: 203 PNSQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMR----PP 258 Query: 594 XGXFXGXXPFXPXXLPP 644 G P PP Sbjct: 259 HGQMHMGGPRPQMGRPP 275 >SB_41909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +2 Query: 377 PXXXPPXXGGXPPXGGXXP-PXPPXKKXFXGGXXPPPXXGPP 499 P PP GG P P P P F PPP G P Sbjct: 90 PFFGPPSDGGFGPSDRGSPVPRPSCGSSFFSERDPPPGKGSP 131 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXG 491 P G PPP PP + G PPPP G Sbjct: 200 PGPGGIPPPPPPIR---GGVPPPPPMG 223 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPP-PPXGXPP 500 PP PPP PP + PP PP PP Sbjct: 558 PPGVDIPPPLPPSEDPKPPPPPPEPPEECPP 588 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/72 (27%), Positives = 22/72 (30%), Gaps = 1/72 (1%) Frame = +2 Query: 377 PXXXPPXXGGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXF-XXPPXKKXPX 553 P PP G P G P P G PP GP G PP + P Sbjct: 1663 PPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGPM 1722 Query: 554 GGGXKKXKKXPP 589 G + PP Sbjct: 1723 GPPGPSGGQGPP 1734 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 499 GGXPXGGGGXXPXKXFFXGGXGGGXXPXG-GXPPXXXGXXXXXFXGG 362 GG GGGG K + GG GGG G G G + GG Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGG 232 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 429 PPPXPPKKKXXXGXXPPPPXGXP 497 PPP PP G PPPP P Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 29.1 bits (62), Expect = 5.2 Identities = 23/95 (24%), Positives = 27/95 (28%), Gaps = 6/95 (6%) Frame = +2 Query: 401 GGXPPXGGXXPPXPPXKKXFXGGXXPPPXXGPPPXGGXXXFXXPPXKKXPXGGG------ 562 G PP P P + G PPP PPP P + P G Sbjct: 298 GYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPP---RAPQGASQTPPYP 354 Query: 563 XKKXKKXPPPXGXFXXGXPXXXPXXXPXPXXXXXP 667 + PPP G + P P P P Sbjct: 355 GSHYSRVPPPDGPYTRALPPGEPYARMPPPGATHP 389 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 501 GGGPXXGGGXXPPXXFFFXGGXGGXXPPXGGXPPXXGGXXXGXF 370 GGG GGG F GG GG GG GG G F Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGF 127 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 429 PPPXPPKKKXXXGXXPPPPXGXPP 500 PPP PP PPPP PP Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPP 106 >SB_41259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 961 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPPXGXPP 500 PP PPP K+ G PPP PP Sbjct: 819 PPTHKPPPPQYSAKRGCPGSEPPPHKPLPP 848 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 412 PPXGXXPPPAPXKKKXXGGXXPPPPXGXPP 501 PP PPP K+ G PPP PP Sbjct: 819 PPTHKPPPPQYSAKRGCPGSEPPPHKPLPP 848 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 414 PXGXXPPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPP 536 P PP PP + PPPP PP G PP Sbjct: 44 PRDRERPPPPPPPRFYDNDIPPPP---PPRRGFYDDYPPPP 81 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 429 PPPXPPKKKXXXGXXPPPPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXKKXPPP 593 PPP PP K PP PP P PP G K K PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPP-------GARPTPPPPPPGKPTKPTKPSLPP 824 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 28.3 bits (60), Expect = 9.2 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +1 Query: 421 GXXPPPAPXKKKXXGGXXPPPPXGXPPXXGXXXXXXXPPKKXPPXGGXKKXXKKXPPXGG 600 G PPP P G PPPP PP P PP + PP GG Sbjct: 119 GYVPPPPPT------GTLPPPPVTPPPGPETPPPPDTPAPPVPP----TEAPPTAPPTGG 168 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +1 Query: 391 PXXXGGXPPXGXXPPPAPXKKKXXGGXXPP-PPXGXPP 501 P G PP PPP P PP PP PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 411 PPXGXXPPPXPPKKKXXXGXXPPPP 485 PP PPP PP PPPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 9.2 Identities = 20/74 (27%), Positives = 20/74 (27%), Gaps = 2/74 (2%) Frame = +3 Query: 405 GXPPXGXXPPPXPPKKKXXXGXXPP--PPXGXPPXXGXXXXXXXPPXKXPPXGGXXKXXK 578 G PP P PP G PP P G PP P P Sbjct: 21 GDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIP 80 Query: 579 KXPPPXGXFXGXXP 620 PPP G P Sbjct: 81 GDPPPNTPIPGNPP 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,469,353 Number of Sequences: 59808 Number of extensions: 341258 Number of successful extensions: 3815 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1509 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -