BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G11 (914 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22014| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-10) 33 0.32 SB_11563| Best HMM Match : SNF7 (HMM E-Value=0.28) 30 3.0 >SB_22014| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-10) Length = 497 Score = 33.1 bits (72), Expect = 0.32 Identities = 19/44 (43%), Positives = 26/44 (59%) Frame = +2 Query: 446 RDRTSEFISTVRSLQGRFLNKPTVRDDRKAAVLETYSQFMSMAK 577 RDRT+EF S V+S+Q R T+ D K +VLE +Q + K Sbjct: 41 RDRTTEFYSAVKSIQSRQSKLATMSKDFK-SVLEVRTQNLKQQK 83 >SB_11563| Best HMM Match : SNF7 (HMM E-Value=0.28) Length = 859 Score = 29.9 bits (64), Expect = 3.0 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 4/86 (4%) Frame = +2 Query: 266 RLLETETDS---YNKLDKKGVHYGESRPYENSSNSKSTLILKSSDQDVFKFLEEFVFEPV 436 R E ET++ KLD+ H +P+E+ S+ T S+D + K E + + Sbjct: 687 RRREAETEAKVLLQKLDRNETHTSRDQPWESVSSHSRTSSGSSNDMEFTKEEETRLKSYI 746 Query: 437 MASRDRTSEFISTVRSLQG-RFLNKP 511 R S STV L+ ++KP Sbjct: 747 QQLRSERSTIGSTVLELESIHGMDKP 772 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,925,382 Number of Sequences: 59808 Number of extensions: 359409 Number of successful extensions: 727 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -