BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G07 (917 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1902.02 |mug72|SPCC663.16c|ketopantoate reductase |Schizosac... 27 4.9 SPCC162.09c |hmg1||3-hydroxy-3-methylglutaryl-CoA reductase|Schi... 26 6.5 SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 26 8.6 >SPCC1902.02 |mug72|SPCC663.16c|ketopantoate reductase |Schizosaccharomyces pombe|chr 3|||Manual Length = 574 Score = 26.6 bits (56), Expect = 4.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 550 TRQTLPGLNPARSYAPIGRATWSP 621 T Q+ P NPA +P+G A+ SP Sbjct: 343 TPQSSPNFNPAMRRSPVGAASRSP 366 >SPCC162.09c |hmg1||3-hydroxy-3-methylglutaryl-CoA reductase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1053 Score = 26.2 bits (55), Expect = 6.5 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 304 LDAAALPTKLLCEGRRSLPHSWPLLLQRSARSWSAALLCASRSTCT 441 LD+++ + + R SW LLQ AR+W L AS+++ T Sbjct: 158 LDSSSTVIQRILPAIREHGISWSWLLQLIARTWMNTLKIASQASKT 203 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 25.8 bits (54), Expect = 8.6 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +3 Query: 285 QCAQVAIGCSRAAHQTALRGSTKPSPQ-LATLTPKVRAFVERSAA 416 Q A I C +A+ T + T L T P+VRAF+E S A Sbjct: 1848 QAAYATIACFISAYDTPAKIVTPVYVSILKTYQPEVRAFIEFSLA 1892 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,169,776 Number of Sequences: 5004 Number of extensions: 35612 Number of successful extensions: 114 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 466510270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -