BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G04 (944 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 3.5 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 4.6 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.0 bits (47), Expect = 3.5 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 5/26 (19%) Frame = +2 Query: 776 PPFXP-----SGXGGGXSPXPPPLXG 838 PP+ P SG GGG S P P G Sbjct: 75 PPYAPHPSLSSGLGGGLSGMPMPALG 100 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +2 Query: 692 KSQAVSPWKAPLVRSPVPDPCRFTGIPXPPFXP 790 + +A SP+ + +P+P+ P PP P Sbjct: 394 RDKAPSPYGGQMFEAPIPNVSPHYVTPTPPEAP 426 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,460 Number of Sequences: 336 Number of extensions: 2184 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26582281 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -