BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G04 (944 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 3e-15 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 7e-15 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 9e-15 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 55 1e-07 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 50 2e-06 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 47 3e-05 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 47 3e-05 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 42 0.001 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 42 0.001 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 42 0.001 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 42 0.001 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) 42 0.001 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 39 0.005 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 37 0.021 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 36 0.048 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 34 0.15 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 33 0.34 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 33 0.34 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 33 0.44 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 33 0.44 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 32 0.78 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.4 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 31 1.8 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 31 1.8 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 3.1 SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) 29 4.1 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_42896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) 28 9.6 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 28 9.6 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 79.8 bits (188), Expect = 3e-15 Identities = 38/62 (61%), Positives = 39/62 (62%) Frame = -2 Query: 631 QGGGAYGKTPATRPFXGXWPFXGLLVXXFFLXXPXIXGXTXXPPLXXLXPLAAXXXPGAX 452 QGGGAYGKTPATRPF G WPF GLL+ FL P I T PPL L PLAA P A Sbjct: 22 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAA 81 Query: 451 XQ 446 Q Sbjct: 82 SQ 83 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 79.4 bits (187), Expect = 4e-15 Identities = 38/65 (58%), Positives = 41/65 (63%) Frame = -2 Query: 649 IFVXLVQGGGAYGKTPATRPFXGXWPFXGLLVXXFFLXXPXIXGXTXXPPLXXLXPLAAX 470 +FV +GGGAYGKTPATRPF G WPF GLL+ FL P I T PPL L PLAA Sbjct: 548 LFVLRGKGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAA 607 Query: 469 XXPGA 455 P A Sbjct: 608 ERPSA 612 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 79.4 bits (187), Expect = 4e-15 Identities = 39/71 (54%), Positives = 40/71 (56%) Frame = -2 Query: 628 GGGAYGKTPATRPFXGXWPFXGLLVXXFFLXXPXIXGXTXXPPLXXLXPLAAXXXPGAXX 449 GGGAYGKTPATRPF G WPF GLL+ FL P I T PPL L PLAA P A Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAK 60 Query: 448 QXXXKRKXAPN 416 Q PN Sbjct: 61 QNGNHTYGLPN 71 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 78.6 bits (185), Expect = 7e-15 Identities = 37/62 (59%), Positives = 39/62 (62%) Frame = -2 Query: 631 QGGGAYGKTPATRPFXGXWPFXGLLVXXFFLXXPXIXGXTXXPPLXXLXPLAAXXXPGAX 452 +GGGAYGKTPATRPF G WPF GLL+ FL P I T PPL L PLAA P A Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAA 464 Query: 451 XQ 446 Q Sbjct: 465 SQ 466 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 78.2 bits (184), Expect = 9e-15 Identities = 37/62 (59%), Positives = 39/62 (62%) Frame = -2 Query: 631 QGGGAYGKTPATRPFXGXWPFXGLLVXXFFLXXPXIXGXTXXPPLXXLXPLAAXXXPGAX 452 +GGGAYGKTPATRPF G WPF GLL+ FL P I T PPL L PLAA P A Sbjct: 758 RGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAA 817 Query: 451 XQ 446 Q Sbjct: 818 SQ 819 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 77.8 bits (183), Expect = 1e-14 Identities = 37/61 (60%), Positives = 38/61 (62%) Frame = -2 Query: 628 GGGAYGKTPATRPFXGXWPFXGLLVXXFFLXXPXIXGXTXXPPLXXLXPLAAXXXPGAXX 449 GGGAYGKTPATRPF G WPF GLL+ FL P I T PPL L PLAA P A Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 60 Query: 448 Q 446 Q Sbjct: 61 Q 61 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 77.8 bits (183), Expect = 1e-14 Identities = 37/61 (60%), Positives = 38/61 (62%) Frame = -2 Query: 628 GGGAYGKTPATRPFXGXWPFXGLLVXXFFLXXPXIXGXTXXPPLXXLXPLAAXXXPGAXX 449 GGGAYGKTPATRPF G WPF GLL+ FL P I T PPL L PLAA P A Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 83 Query: 448 Q 446 Q Sbjct: 84 Q 84 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 93 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 136 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 59 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 102 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 57.6 bits (133), Expect = 1e-08 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FFP PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 54.8 bits (126), Expect = 1e-07 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = +2 Query: 374 CXNXSAXPRGKAVXVWGXLPLPXXLTXCPRXXGCGXRXQXPQRR 505 C N SA RG+AV V G LPLP LT C R GCG R Q QRR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 54.8 bits (126), Expect = 1e-07 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = +2 Query: 374 CXNXSAXPRGKAVXVWGXLPLPXXLTXCPRXXGCGXRXQXPQRR 505 C N SA RG+AV V G LPLP LT C R GCG R Q QRR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 54.0 bits (124), Expect = 2e-07 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 Query: 629 GGRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GGRSLW NA + AFL LA WPF FF PD NR TAF Sbjct: 17 GGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAF 60 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 54.0 bits (124), Expect = 2e-07 Identities = 24/43 (55%), Positives = 26/43 (60%) Frame = -1 Query: 626 GRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 GRSLW NA + AFL LA WPF F+P PD NR TAF Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAF 44 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 50.4 bits (115), Expect = 2e-06 Identities = 31/76 (40%), Positives = 32/76 (42%) Frame = -1 Query: 626 GRSLWXNAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAFXGAXTAXRXRXXGGXXS 447 GRSLW NA + AFL LA WPF F P PD TAF A R S Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIARSSRMHERRES 61 Query: 446 VXXEAEXXPKRXPPFP 399 V EAE R P Sbjct: 62 VSEEAEERSIRKQTLP 77 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 46.8 bits (106), Expect = 3e-05 Identities = 35/87 (40%), Positives = 40/87 (45%) Frame = +2 Query: 524 NXGXXQEKTXNQKAXKXPXTXKRPXGXRFXIGSAPLDEXHKNRXSSRRWGXPTGLXKSQA 703 N G QE+T QKA K P T KRP RF IGSAPL K + R G K Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITK-IDAQVRGGETRQDYKDTR 144 Query: 704 VSPWKAPLVRSPVPDPCRFTGIPXPPF 784 P +AP + + PCR PPF Sbjct: 145 RFPLEAPSC-ALLFRPCRLPD-TCPPF 169 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 46.8 bits (106), Expect = 3e-05 Identities = 35/87 (40%), Positives = 40/87 (45%) Frame = +2 Query: 524 NXGXXQEKTXNQKAXKXPXTXKRPXGXRFXIGSAPLDEXHKNRXSSRRWGXPTGLXKSQA 703 N G QE+T QKA K P T KRP RF IGSAPL K + R G K Sbjct: 115 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITK-IDAQVRGGETRQDYKDTR 173 Query: 704 VSPWKAPLVRSPVPDPCRFTGIPXPPF 784 P +AP + + PCR PPF Sbjct: 174 RFPLEAPSC-ALLFRPCRLPD-TCPPF 198 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/44 (56%), Positives = 27/44 (61%) Frame = +3 Query: 633 TSXTKIDXQVGGGEXRQDYXNPRXFPPGKLPSCALRFPTPAXLP 764 TS TK D Q+ GGE RQDY + R FP PSCAL F P LP Sbjct: 121 TSITKSDAQISGGETRQDYKDTRRFPLA-APSCALLF-LPFGLP 162 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/37 (54%), Positives = 21/37 (56%) Frame = -1 Query: 608 NAXHXAFLXXLAXXWPFGXXFFPXXXPDXGXNRXTAF 498 NA + AFL LA WPF FFP PD NR TAF Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 56 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 100 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 451 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 495 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 578 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 622 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 10 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 54 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 5 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 49 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 312 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 356 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 39 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 83 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 212 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 256 >SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) Length = 302 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 257 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 301 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 143 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 187 >SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 2 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 46 >SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 5 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 49 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 266 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 310 >SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) Length = 117 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R AVSA KAV R S SG GKN Sbjct: 72 RIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 116 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = -1 Query: 746 REPESARGELSRGKXPGIXIVLSGFPTSDLXVDFCXARPGG 624 +E ESARG +G+ GI IVLSGF T+DL V F A GG Sbjct: 9 QEQESARGS-RQGETLGIFIVLSGFATTDLSVRFRDACQGG 48 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/45 (51%), Positives = 24/45 (53%) Frame = +1 Query: 415 RLGXXSASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 R+G SAS TD L R R A SA KAV R S SG GKN Sbjct: 5 RIGRSSASSLTDSLRSVVRLRRAESAHSKAVIRLSTESGDNAGKN 49 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +1 Query: 430 SASXXTDXLPPXXRXRXAVSAPXKAVXRXSPXSGXXXGKN 549 SAS TD L R R AVSA KAV R S SG GKN Sbjct: 69 SASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 108 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 770 PXPPFXPSGXGGGXS-PXPPPLXGISNSGVRSXPPQXXGWGXXNPP 904 P PP P G GG P PPPL G G PP G G PP Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPG----GAAPPPPPPIGGGAPPPP 703 Score = 33.1 bits (72), Expect = 0.34 Identities = 21/62 (33%), Positives = 25/62 (40%) Frame = +2 Query: 698 QAVSPWKAPLVRSPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISNSGVRSXPPQX 877 +A +P P P P + G P PP P GG P PPP+ G G PP Sbjct: 652 EAATPEAGPPPPPPPPPGGQAGGAPPPP-PPPLPGGAAPPPPPPIGG----GAPPPPPPG 706 Query: 878 XG 883 G Sbjct: 707 FG 708 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 734 SPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISN 847 +P P P G PP P GG P PP G +N Sbjct: 675 APPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGGFAN 712 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 801 GGAFXXXPPPXXVSXIPGLGXXPPXXGGGVPXTPP 905 GGA PPP P PP GGG P PP Sbjct: 673 GGAPPPPPPPLPGGAAP---PPPPPIGGGAPPPPP 704 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +2 Query: 740 VPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISNSGVRSXPPQXXGWGXXNPP 904 VPD G P PP P G +P PPP G + PP G G PP Sbjct: 280 VPDIVTGGGAPVPP-PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPP 333 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 734 SPVPDPCRFTG-IPXPPFXPSGXGGGXSPXPPPLXGISNSGVRSXPP 871 +PVP P G P PP P G P PPP + G PP Sbjct: 289 APVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/72 (30%), Positives = 25/72 (34%) Frame = +3 Query: 711 PGKLPSCALRFPTPAXLPEYLXRLSXLRGXGGAFXXXPPPXXVSXIPGLGXXPPXXGGGV 890 P PS P L + + + GGA PPP S P PP GG Sbjct: 257 PSIAPSVPQGLDLPDVLEHDIPEVPDIVTGGGAPVPPPPPADGS-APA-PPPPPPPGGAP 314 Query: 891 PXTPPXXPXXXG 926 P PP P G Sbjct: 315 PPPPPPPPPPPG 326 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 770 PXPPFXPSGXGGGXSPXPPP 829 P PP P G GG P PPP Sbjct: 318 PPPPPPPPGDGGAPPPPPPP 337 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +3 Query: 633 TSXTKIDXQVGGGEXRQDYXNPR 701 TS TK D Q+ GGE RQDY + R Sbjct: 159 TSITKSDAQISGGETRQDYKDTR 181 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 33.1 bits (72), Expect = 0.34 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +2 Query: 722 PLVRSPVPDPCRFTGIPXPPFXPS-GXGGGXSPXPPPLXGISNSGVRSXPP 871 P+ P P P G+P PP P G G P PPP G +G+ PP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGC--AGLPPPPP 758 Score = 28.7 bits (61), Expect = 7.2 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +2 Query: 737 PVPDPCRFTGI----PXPPFXPSGXGGGXSPXPPPLXGISNSGVRSXPPQXXGWGXXNPP 904 P P P +G P PP P G G P P P G + PP G PP Sbjct: 698 PPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 737 PVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPL 832 P P P G+P PP P G P PPP+ Sbjct: 730 PSPQP-GCAGLPPPPPPPPPGCAGLPPPPPPI 760 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 32.7 bits (71), Expect = 0.44 Identities = 24/71 (33%), Positives = 30/71 (42%) Frame = +2 Query: 671 GXPTGLXKSQAVSPWKAPLVRSPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISNS 850 G P + QA +P PL +P P P +P PP G +P PPP+ S Sbjct: 297 GPPLPPSRDQAPAP-PPPLNATPPPPPPSRDQVPLPP---PPLRGQIAPPPPPISKPPTS 352 Query: 851 GVRSXPPQXXG 883 RS PP G Sbjct: 353 -TRSAPPPPPG 362 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 32.7 bits (71), Expect = 0.44 Identities = 24/71 (33%), Positives = 30/71 (42%) Frame = +2 Query: 671 GXPTGLXKSQAVSPWKAPLVRSPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISNS 850 G P + QA +P PL +P P P +P PP G +P PPP+ S Sbjct: 209 GPPLPPSRDQAPAP-PPPLNATPPPPPPSRDQVPLPP---PPLRGQIAPPPPPISKPPTS 264 Query: 851 GVRSXPPQXXG 883 RS PP G Sbjct: 265 -TRSAPPPPPG 274 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 822 PPPXXVSXIPGLGXXPPXXGGGVPXTPPXXPXXXGP 929 PP P +G PP GG P PP P P Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPP 375 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +2 Query: 776 PPFXPSGXGGGXSPXPPPLXGISNSGVRSXPPQXXGWGXXNPP 904 PP P GG P PPP+ G S + + PP PP Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 801 GGAFXXXPPPXXVSXIPGLGXXP--PXXGGGVPXTPPXXPXXXGP 929 G A PPP + PG G P P GG P PP P P Sbjct: 950 GNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 30.7 bits (66), Expect = 1.8 Identities = 30/100 (30%), Positives = 33/100 (33%), Gaps = 12/100 (12%) Frame = +2 Query: 641 HKNRXSSRRWGXPTGLXKSQAVSPWKAPLVRS-PVPDPCRFTGIPXPPFXPSGX------ 799 HKN S R + SP +P S P P P P PP P G Sbjct: 887 HKNDGSFPRRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPP 946 Query: 800 --GGGXSPXPPPLXGIS---NSGVRSXPPQXXGWGXXNPP 904 GG P PPP G + G PP G PP Sbjct: 947 PPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPP 986 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +2 Query: 704 VSPWKAPLVRSPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXG 838 +S + + + P P P PP P G GG P PPP G Sbjct: 175 ISNLSSAMAAANKPSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFG 219 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/50 (42%), Positives = 24/50 (48%) Frame = +2 Query: 734 SPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISNSGVRSXPPQXXG 883 SP D +T +P PP P G GG P PPP+ G GV PP G Sbjct: 184 SPTEDT-PWTSVPPPP--PPGPGGIP-PPPPPIRG----GVPPPPPMGGG 225 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 710 PWKAPLVRSPVPDP--CRFTGIPXPPFXPSGXGGGXSPXPPPL 832 P +P R+P P P TG P PP P G P PPP+ Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPP-PPIAPATGGPPPPPPI 170 Score = 29.5 bits (63), Expect = 4.1 Identities = 21/70 (30%), Positives = 29/70 (41%) Frame = +2 Query: 695 SQAVSPWKAPLVRSPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISNSGVRSXPPQ 874 +Q+V+P P R+P P + P PP P+ P PPP+ + G PP Sbjct: 103 AQSVAPTPPPPPRAP-ETPSQAPSPPPPPTSPATRA---PPPPPPI-APATGGPPPPPPI 157 Query: 875 XXGWGXXNPP 904 G PP Sbjct: 158 APATGGPPPP 167 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/69 (27%), Positives = 26/69 (37%), Gaps = 4/69 (5%) Frame = +2 Query: 677 PTGLXKSQAVSPWKAPLVRSPVPDPCRFTGI----PXPPFXPSGXGGGXSPXPPPLXGIS 844 PT ++ P V +P P P + P PP P SP PPP + Sbjct: 76 PTPQTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPP----T 131 Query: 845 NSGVRSXPP 871 + R+ PP Sbjct: 132 SPATRAPPP 140 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 30.3 bits (65), Expect = 2.4 Identities = 30/97 (30%), Positives = 33/97 (34%), Gaps = 7/97 (7%) Frame = +2 Query: 668 WGXPT-GLXKSQAVSPWKAPLVRSPVPDPCRFTGIPXPPFXPSGXGGGXSPX------PP 826 WG P G + P A P P P G PP +G GGG P PP Sbjct: 523 WGQPPPGAGQGGGPPPPGAGQGGGP-PPPGAGQGWGQPP-PGAGQGGGPPPPGAGQGGPP 580 Query: 827 PLXGISNSGVRSXPPQXXGWGXXNPPXXXXXRWALYP 937 P +G PP G G PP W L P Sbjct: 581 P----PGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPP 613 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +2 Query: 764 GIPXPPFXPSGXGGGXS--PXPPPLXGISNSGV 856 G+P PP P G P PPP G+SNSG+ Sbjct: 278 GMP-PPMPPGGMPPNMEQPPPPPPSSGVSNSGM 309 >SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) Length = 635 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 7/38 (18%) Frame = -2 Query: 682 CRXSPP------PT*XSI-FVXLVQGGGAYGKTPATRP 590 CR +PP P S+ F QGGGAYGKT RP Sbjct: 113 CRYAPPLLSGFAPPDLSVRFRDACQGGGAYGKTALPRP 150 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/54 (31%), Positives = 20/54 (37%) Frame = +2 Query: 722 PLVRSPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISNSGVRSXPPQXXG 883 P +P P + TG P P GG P PP G+R PP G Sbjct: 421 PAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMG 474 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 725 LVRSPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPP 829 L +P+ + +P PP P+ G G P PPP Sbjct: 740 LTWTPLTNTSSAANVPPPPPPPAVPGEGARPPPPP 774 >SB_42896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 728 VRSPVPDPCRFTGIPXPPFXPSGXGGG 808 VR PVP+ P PF P GGG Sbjct: 923 VRGPVPEKATLAEGPRAPFTPQSYGGG 949 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 28.7 bits (61), Expect = 7.2 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = +2 Query: 701 AVSPWKAPLVR-SPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISNSGVRSXPP 871 A SP P +R S V P R TG P PP + PPP +N PP Sbjct: 509 AESPPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPP 566 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 696 PRXFPPGKLPSCALRFPTPAXLP 764 P PPG++P L FP P +P Sbjct: 225 PGGMPPGRMPPQGLPFPPPGPIP 247 >SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) Length = 399 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +2 Query: 710 PWKAPLVRSPVPDPCRFTGIPXPPFXPSGXGGGXSPXPPP 829 P AP VR +P +P P PS G P PPP Sbjct: 225 PCPAPRVRKTIPSST--DSLPRPGRPPSPSTRGMKPLPPP 262 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = +2 Query: 743 PDPCRFTGIPXPPFXPSGXGGGXSPXPPPLXGISNSGVRSXPP 871 P+P F GIP PP P G G P PPP G G PP Sbjct: 645 PNPF-FGGIPPPP--PGG--GMFPPPPPPPPGGGVPGPPKPPP 682 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 2/62 (3%) Frame = +2 Query: 659 SRRWGXPTGLXKSQAVSPWKAPLVRSPVPDPC--RFTGIPXPPFXPSGXGGGXSPXPPPL 832 SRR+ T + + P PL +P P P PP P+G P PPP+ Sbjct: 267 SRRY---TNTQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPM 323 Query: 833 XG 838 G Sbjct: 324 LG 325 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,727,031 Number of Sequences: 59808 Number of extensions: 311992 Number of successful extensions: 1457 Number of sequences better than 10.0: 90 Number of HSP's better than 10.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1361 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2764790632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -