BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_G02 (821 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 25 2.8 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 8.6 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 25.0 bits (52), Expect = 2.8 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +1 Query: 391 NERKSQDKHTENLIPNLTNSHKSYGYTGIDKDESIVSQDKVAFTNDNG-NL-YQSKESHS 564 ++R ++D EN+ TNS + + + S Q + +D NL +SK S S Sbjct: 255 SDRLTEDDEDENISVTRTNSTIRSRSSSLSRSRSCSRQAETPRADDRALNLDTKSKPSTS 314 Query: 565 ENSGT 579 +SGT Sbjct: 315 SSSGT 319 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 23.4 bits (48), Expect = 8.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 81 LYYPRHVSQRKNQILRIPY 25 ++Y +H Q Q LR+PY Sbjct: 245 IFYYKHAEQLGAQFLRLPY 263 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 802,916 Number of Sequences: 2352 Number of extensions: 15643 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -