BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F24 (909 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2BBJ9 Cluster: Putative uncharacterized protein; n=1; ... 35 3.3 UniRef50_A6EP00 Cluster: DNA topoisomerase IV subunit B; n=1; un... 34 5.8 >UniRef50_Q2BBJ9 Cluster: Putative uncharacterized protein; n=1; Bacillus sp. NRRL B-14911|Rep: Putative uncharacterized protein - Bacillus sp. NRRL B-14911 Length = 192 Score = 34.7 bits (76), Expect = 3.3 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +1 Query: 331 DPDNKTFLPIGSKEIGTVYPKNIFTKVVKINKINSPREQLAEFRKDHYFDRFRGD 495 D K L GS+ I + YP F KV I + + + L+ F++DH+ DR+ G+ Sbjct: 17 DSIEKGHLNSGSELIKSYYP---FQKVEYIKRTYTKADMLSIFQRDHFIDRYSGE 68 >UniRef50_A6EP00 Cluster: DNA topoisomerase IV subunit B; n=1; unidentified eubacterium SCB49|Rep: DNA topoisomerase IV subunit B - unidentified eubacterium SCB49 Length = 47 Score = 33.9 bits (74), Expect = 5.8 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +2 Query: 206 LXVFQDV*DHTVTNGLVTCPKVLLINCVKGRSTSIQILNFIGTLIIK 346 + VF D ++T V C V +++ VK S+S+++LN IG IIK Sbjct: 1 MNVFIDTLQFSITTKEVACFNVKILSEVKHNSSSVEVLNNIGYNIIK 47 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,212,729 Number of Sequences: 1657284 Number of extensions: 11704377 Number of successful extensions: 27764 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27762 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 82801539422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -