Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_F24
         (909 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863...    29   6.7  

>03_02_0455 -
           8630543-8630893,8630994-8631068,8631149-8631223,
           8631332-8631397,8631891-8631967,8632659-8633070
          Length = 351

 Score = 28.7 bits (61), Expect = 6.7
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
 Frame = +1

Query: 229 RPYRYKRFSDVPEGIIN-KLRQRAFHKYPDLEF-YWDPDNKTFL 354
           + Y+Y  F+  P  II  K+      K  D  F YWDPD K ++
Sbjct: 192 KKYQYLLFAAEPYEIIGFKIPSAEIDKSADKFFNYWDPDKKQYI 235


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,188,917
Number of Sequences: 37544
Number of extensions: 297378
Number of successful extensions: 516
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 509
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 516
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2577242800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)