BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fdpeP01_F_F23
(908 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 23 4.4
>AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor
subunit protein.
Length = 243
Score = 22.6 bits (46), Expect = 4.4
Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 2/53 (3%)
Frame = +3
Query: 12 LXTHYREFLKIFGNNSCTRS--TDVTPSCYTKVNLTTLYYSICLI*AEYLYYS 164
+ T EF+++ + S TRS +T SC + + +C I E Y+
Sbjct: 139 IATTSNEFIRVHHSGSITRSIRLTITASCPMNLQYLPMDRQLCHIEIESFGYT 191
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 154,349
Number of Sequences: 336
Number of extensions: 2827
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 25341085
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -