BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F23 (908 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 28 0.45 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 23 9.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 9.7 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 9.7 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 23 9.7 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 27.9 bits (59), Expect = 0.45 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -3 Query: 447 DHIA--PSEREVPCRPTFVRPSCPGLLQRHDARKTSRRRIL 331 DH++ P REV R + + LL+ H KTS+ R+L Sbjct: 806 DHLSWLPHVREVTTRARKIADAVTRLLRNHSGPKTSKARLL 846 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.4 bits (48), Expect = 9.7 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -1 Query: 416 PAVQHSSVHRVQGFFSVTTLEKPHE 342 P H S HR+ G F + + P++ Sbjct: 32 PRSPHGSGHRIVGGFEINVSDTPYQ 56 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 9.7 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 458 DEGATISRHLNAKFPAVQHSSVHRVQGFFSVTTLE 354 D+ I+ HL+A F AV+H + + + T ++ Sbjct: 419 DKLTQINIHLHALFSAVEHGHLEKARTILESTDVD 453 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.4 bits (48), Expect = 9.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 166 NELRKTSATNRWHGLV 213 N L T+ATNR+ GLV Sbjct: 426 NGLHSTTATNRFSGLV 441 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 23.4 bits (48), Expect = 9.7 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 360 RRDAEEALDTMDGRMLDGRELRVQMARYGRPLIAIQESLR 479 +R EEA + D +LRV+ LIAI LR Sbjct: 78 QRREEEARRREEAAKADNEKLRVEQQETHTTLIAISAQLR 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 687,036 Number of Sequences: 2352 Number of extensions: 12538 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 98401338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -