BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F22 (921 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 33 1.9 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 33 1.9 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 33 1.9 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 31 5.9 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 31 5.9 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 32.7 bits (71), Expect = 1.9 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 608 GXKKFXXPPPVGPXXXIKIXGXPXPPPXXGAXXXGXVXXXXXPPXPP 748 G K PPP P + G P PPP G G P PP Sbjct: 311 GPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPP 357 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 32.7 bits (71), Expect = 1.9 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 608 GXKKFXXPPPVGPXXXIKIXGXPXPPPXXGAXXXGXVXXXXXPPXPP 748 G K PPP P + G P PPP G G P PP Sbjct: 311 GPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPP 357 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 32.7 bits (71), Expect = 1.9 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 608 GXKKFXXPPPVGPXXXIKIXGXPXPPPXXGAXXXGXVXXXXXPPXPP 748 G K PPP P + G P PPP G G P PP Sbjct: 311 GPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPP 357 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 31.1 bits (67), Expect = 5.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 629 PPPVGPXXXIKIXGXPXPPPXXGAXXXGXVXXXXXPPXPP 748 PPP P + G P PPP G G P PP Sbjct: 446 PPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPP 485 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 31.1 bits (67), Expect = 5.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 629 PPPVGPXXXIKIXGXPXPPPXXGAXXXGXVXXXXXPPXPP 748 PPP P + G P PPP G G P PP Sbjct: 317 PPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPP 356 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,734,751 Number of Sequences: 237096 Number of extensions: 1420105 Number of successful extensions: 2174 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2025 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11992411152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -