BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F21 (1001 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L10990-8|AAB59173.2| 223|Caenorhabditis elegans Hypothetical pr... 32 0.74 AF024502-6|AAB70378.4| 402|Caenorhabditis elegans Hypothetical ... 29 5.2 >L10990-8|AAB59173.2| 223|Caenorhabditis elegans Hypothetical protein C30A5.3 protein. Length = 223 Score = 31.9 bits (69), Expect = 0.74 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 606 YKDTRRFPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIA 728 Y+ R+F +E ALL + +P+TC + E W FL A Sbjct: 71 YEHLRQFCIELNGLALLLQRECIPETCQQMTATEQWIFLCA 111 >AF024502-6|AAB70378.4| 402|Caenorhabditis elegans Hypothetical protein M151.1 protein. Length = 402 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = -1 Query: 794 DGXAHSPAWSERPTPN*DTYSVSYEKAPRFPKGERRTGIR*AAGSEQESARGSFQGETPG 615 D H AW+ R P ++ + K ++ K E + G G+E+ +G+T Sbjct: 92 DQLKHDKAWNNRSLPQKSRWNQASVKLAQYQKAEEKMGFIKVFGTEEFQNYSKRRGQTRN 151 Query: 614 IF 609 F Sbjct: 152 SF 153 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,405,622 Number of Sequences: 27780 Number of extensions: 381354 Number of successful extensions: 962 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2626021738 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -