BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F20 (874 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 6.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.4 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 6.4 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 713 TASQPIQYVQNNQRSKLPLQLLFCTRYQIKYCPXL 817 ++SQP+Q Q N LP+ + T + Y P + Sbjct: 815 SSSQPMQPPQQNPYMFLPVSYMSTTMAGVIYPPVI 849 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 675 QFQDHHKVNQ*HQLHH--SLFNMYKITRGQSCPCSSCFVQD 791 Q Q + Q QL+H L N+Y + + C S + D Sbjct: 1454 QQQQQQQQQQQQQLNHYPDLHNLYAVPTDKKSACDSKLIVD 1494 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,245 Number of Sequences: 438 Number of extensions: 2647 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28280841 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -