BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F19 (853 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY075533-1|AAL68340.2| 68|Drosophila melanogaster RH06643p pro... 120 3e-27 AE014297-1040|AAF54450.1| 56|Drosophila melanogaster CG8495-PA... 120 3e-27 BT001305-1|AAN71060.1| 43|Drosophila melanogaster AT13329p pro... 79 6e-15 AE014297-1041|AAN13446.1| 55|Drosophila melanogaster CG8495-PC... 79 6e-15 >AY075533-1|AAL68340.2| 68|Drosophila melanogaster RH06643p protein. Length = 68 Score = 120 bits (288), Expect = 3e-27 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = +1 Query: 124 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 291 MG A +WYSHPR+YGQGSR CR+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD Sbjct: 13 MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 68 >AE014297-1040|AAF54450.1| 56|Drosophila melanogaster CG8495-PA, isoform A protein. Length = 56 Score = 120 bits (288), Expect = 3e-27 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = +1 Query: 124 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 291 MG A +WYSHPR+YGQGSR CR+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD Sbjct: 1 MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 56 >BT001305-1|AAN71060.1| 43|Drosophila melanogaster AT13329p protein. Length = 43 Score = 79.4 bits (187), Expect = 6e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 187 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 291 R+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD Sbjct: 9 RACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 43 >AE014297-1041|AAN13446.1| 55|Drosophila melanogaster CG8495-PC, isoform C protein. Length = 55 Score = 79.4 bits (187), Expect = 6e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 187 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 291 R+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD Sbjct: 21 RACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 55 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,234,151 Number of Sequences: 53049 Number of extensions: 405576 Number of successful extensions: 774 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4085918148 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -