BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F18 (907 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03260.1 68414.m00304 expressed protein 28 7.4 At3g08670.1 68416.m01007 expressed protein 28 9.8 >At1g03260.1 68414.m00304 expressed protein Length = 274 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 677 VFPTLPFEMINVVLSASDARIG 742 V P LPF M+N +LS + R+G Sbjct: 142 VVPILPFNMLNYLLSVTPVRLG 163 >At3g08670.1 68416.m01007 expressed protein Length = 567 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +2 Query: 140 PQ*RSSSIKQGAPPPRXVVTLTSSTPNRSHRGPDAVPFHQAQRALSATDKETSRKRP 310 P RSSS + + P R SSTP+R G + +A+ +LS+ T RP Sbjct: 196 PSSRSSSSARPSTPTRTSSASRSSTPSRIRPGSSSSSMDKARPSLSSR-PSTPTSRP 251 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,325,727 Number of Sequences: 28952 Number of extensions: 305294 Number of successful extensions: 773 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -