BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F17 (917 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0302 - 2021221-2023305 32 0.73 01_03_0117 + 12684729-12685886,12685978-12686145,12686292-126863... 30 2.2 02_05_0686 - 30900748-30902167,30903442-30904742 28 9.0 >02_01_0302 - 2021221-2023305 Length = 694 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 777 VXXSPXPGKXGPXPKXXXLXGSPXSGXRSXXPXWG--GXXPPXPTVP 911 V +P PG GP P GSP S P G G PP VP Sbjct: 563 VRFAPPPGSYGPIPSTPPSSGSPPSPSSGYQPPSGQPGASPPTQHVP 609 >01_03_0117 + 12684729-12685886,12685978-12686145,12686292-12686336, 12686438-12687280 Length = 737 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/63 (30%), Positives = 22/63 (34%) Frame = +1 Query: 631 RPPEQASQKXTXXSKXANPXXXIKIXXXPPETXPVXPPFXDPAXLXXXXSXFPPXRXXGA 810 +PP A K + A P + PP PV PP PA FPP Sbjct: 217 KPPAYAPAKPPTALRPAIPPAAMP---KPPSVAPVQPPQRPPAPATKPPPSFPPQLAPTM 273 Query: 811 PXP 819 P P Sbjct: 274 PPP 276 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 28.3 bits (60), Expect = 9.0 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = +3 Query: 705 PXXSP*NXPXAPPFXXPCPLXGXXVXXSPXPGKXGPXPKXXXLXGSPXSGXRSXXPXWGG 884 P P P PP P P P P K GP P G G P G Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPK-GPSPPPPPPPGGKKGGPPPPPPKGGA 386 Query: 885 XXPP-XPTVP 911 PP P VP Sbjct: 387 SRPPAAPGVP 396 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,903,983 Number of Sequences: 37544 Number of extensions: 215324 Number of successful extensions: 234 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 230 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2612387020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -