BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F15 (995 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 2.8 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 697 GPPPGXGXPPXGGPXXXF 750 G PP G PP G P F Sbjct: 66 GGPPSGGQPPQGMPYPRF 83 Score = 23.0 bits (47), Expect = 3.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 696 GPPPGXGXPPXGXP 737 G PP G PP G P Sbjct: 66 GGPPSGGQPPQGMP 79 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/30 (40%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = -3 Query: 993 PAGRXRDXXPPPPXGGXRXGGXP--GXPXP 910 P+ R PP GG GG P G P P Sbjct: 52 PSVGLRQGIPPHHYGGPPSGGQPPQGMPYP 81 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,575 Number of Sequences: 336 Number of extensions: 1927 Number of successful extensions: 11 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 28340642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -