BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F15 (995 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 1e-04 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 41 0.002 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 41 0.002 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 40 0.002 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 40 0.003 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 40 0.003 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 38 0.010 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 38 0.010 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 38 0.013 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) 36 0.039 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.089 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 35 0.089 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 35 0.089 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.089 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.089 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.089 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 34 0.16 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 34 0.16 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 34 0.16 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 34 0.21 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 33 0.27 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 33 0.48 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 33 0.48 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.48 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 32 0.63 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.83 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 32 0.83 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 31 1.5 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_31319| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) 30 2.5 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 30 2.5 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 4.4 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 4.4 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 29 4.4 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 5.9 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 5.9 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 29 5.9 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 5.9 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 29 5.9 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 29 5.9 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 29 7.8 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.8 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 29 7.8 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 7.8 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 29 7.8 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.8 SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) 29 7.8 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 23 9.7 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 50.4 bits (115), Expect = 2e-06 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 646 PXPPXGG-PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP G PPP PPPG G PP P PPPPPP PP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 45.2 bits (102), Expect = 8e-05 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 9/58 (15%) Frame = +1 Query: 646 PXPPXGG------PPPXXXFWXXGPPPGXGXPPXGG---PXXXFXXGXPPPPPPXXPP 792 P PP GG PPP PPPG PP GG P G PPPPP PP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 637 VXSPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 V P PP GG P PPPG P P PPPP PP Sbjct: 919 VPPPPPPPGGNAPLPP-----PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP 965 Score = 31.9 bits (69), Expect = 0.83 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 S PP G PP PPPG P P PPPP PP Sbjct: 911 SASPPGGSVPPPP------PPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP 954 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 SP PP PPP PPP PP P PPPPPP PP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP PPP PP P PPPPPP PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP PPP PP P PPPPPP PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP PPP PP P PPPPPP PP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP PPP PP P PPPPPP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP PPP PP P PPPPPP PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP PPP PP P PPPPPP PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 P PP PPP PPP PP P PPPPPP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 SP PP PPP PPP PP P PP PPP PP Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP PPP PP P PPPPPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXG-PPPGXGXPPXGGPXXXFXXGXPPPP--PPXXPP 792 PP G PPP G PPPG PP P G PPP PP PP Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Score = 33.1 bits (72), Expect = 0.36 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 8/55 (14%) Frame = +1 Query: 652 PPXGGPPPXXX----FWXXGPPPGXGXPPXGGPXXXFXXGXPP----PPPPXXPP 792 PP G PPP F G P G PP G P G PP PPPP PP Sbjct: 248 PPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPP--PP 300 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PP GG PP + GPPP P GGP G PP P P Sbjct: 53 PPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAP 99 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP 777 P P G PP + PP G PP GG G PPP P Sbjct: 24 PAAPGGYPPAPGGY----PPAPGGYPPSGGYGYPPAGGYPPPQP 63 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = -1 Query: 767 GGXPXXXXXXGPPXGGXPXP----GGGPXXQXKXXG-GGPPXGG 651 GG P PP GG P P GGP G GGPP G Sbjct: 42 GGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSG 85 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -1 Query: 767 GGXPXXXXXXGPPXG-GXPXPGGGPXXQXKXXGGGPPXG 654 GG P P G G P GG P Q GG PP G Sbjct: 35 GGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPG 73 Score = 29.1 bits (62), Expect = 5.9 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 P GGPPP + G PP P G P G PPP P Sbjct: 76 PGIGGPPPSGQY---GAPP--TSQPYGAPPTSGYPGYQQHPPPPQP 116 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 664 GP-PPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 GP P W GPPP G PP GGP G PPPPPP Sbjct: 198 GPYPGQPGMW--GPPPMGGPPPMGGP----PGGYPPPPPP 231 Score = 32.3 bits (70), Expect = 0.63 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPP 771 PP GGPPP G PPG G PP P PPP Sbjct: 210 PPMGGPPPM------GGPPG-GYPPPPPPPGAGDPAYPPP 242 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 P GPPP GPPP G PP G P PPPPPP Sbjct: 204 PGMWGPPPMG-----GPPP-MGGPPGGYP--------PPPPPP 232 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 689 GAXAPPRXGXPPXGXAPXGXFXXGXPPPPP 778 G PP G PP P G G PPPPP Sbjct: 205 GMWGPPPMGGPPPMGGPPG----GYPPPPP 230 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP-XXPP 792 P PP GPPP PPP G PP P G PPPPPP PP Sbjct: 377 PPPPTNGPPPP-------PPPTNGPPPPPPPTN----GPPPPPPPTNGPP 415 Score = 38.3 bits (85), Expect = 0.010 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 643 SPXPPXGG---PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 SP PP PPP PPP G PP P G PPPPPP P Sbjct: 356 SPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP----TNGPPPPPPPTNGP 404 Score = 34.3 bits (75), Expect = 0.16 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGG--PXXXFXXGXPPPPPPXXPP 792 P P PPP GPPP PP G P G PPPPPP P Sbjct: 368 PPPTNKPPPPPPP--TNGPPP--PPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 31.9 bits (69), Expect = 0.83 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 637 VXSPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 V P PP PP PPP PP P PPPPP PP Sbjct: 344 VNPPPPPTNNPPSP-------PPPTNNTPP---PPPPTNKPPPPPPPTNGPP 385 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 666 PPPXXLXLXPGPPPGXGXPPXGXPXXGXXXRG 761 PPP P PPP G PP P G G Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEG 418 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 5/54 (9%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGX-----GXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP PPP G PP P G PPPPPP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGX-------GXPPXGGPXXXFXXGXPPPPPPXXP 789 P PP PPP PPP G PP G PPPPPP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 P PP G PP PP G PP P G PPPPPP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP--VGGPPPPPPP 380 Score = 38.3 bits (85), Expect = 0.010 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 P PP GGPPP PPP G PP G PPPPPP Sbjct: 367 PPPPVGGPPPP-------PPPIEGRPPSS-------LGNPPPPPP 397 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +1 Query: 652 PPXGG--PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PP GG PPP GPPP P G P PPPPP P Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPP-PPIEGRPPSSLGNPPPPPPPGRGAP 403 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 P P G PP PPP G P P G PPPPP Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSRGSAP---PPPPARMGTAPPPPP 330 Score = 32.7 bits (71), Expect = 0.48 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +1 Query: 667 PPPXXXFWXXGPPPGXGXPPXG--GPXXXFXXGXPPPPPPXXP 789 PPP PPP G PP G G PPPPP P Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 29.9 bits (64), Expect = 3.4 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 6/48 (12%) Frame = +1 Query: 667 PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPP------PPXXPP 792 PPP PPP G PP P PPPP PP PP Sbjct: 287 PPPPPSRGAAPPPPSRGAPP---PPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 29.1 bits (62), Expect = 5.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGX--GXPPXGGPXXXFXXGXPPPPPPXXPP 792 P P G PPP PPP G P P PPP PP Sbjct: 298 PPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPP 348 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXG 732 P P G PP PPPG G PP G Sbjct: 378 PPPIEGRPPSSLGNPPPPPPPGRGAPPPG 406 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 660 GGPPPXXLXLXPGPPPGXGXPPXGXPXXG 746 G PP P PPPG G PP G G Sbjct: 383 GRPPSSLGNPPPPPPPGRGAPPPGPMIPG 411 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PPP PPP G P P G P PPPP PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 +P PP PP PPPG P GGP PPPPP PP Sbjct: 340 APPPPPISKPPTSTRSAPPPPPGRAPQPLGGP--------PPPPPGRRPP 381 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP 777 P PP PPP PPP P G P F PP PP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPP----PTRGPPSNSFTTQGPPLPP 302 Score = 31.9 bits (69), Expect = 0.83 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 SP PP G PPP P G P P G PPPP P Sbjct: 139 SPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPP-----MGKPPPPSGNKP 182 Score = 31.9 bits (69), Expect = 0.83 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP 777 +P PP PP F GPP P PPPPP Sbjct: 279 NPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 323 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +1 Query: 646 PXPPXGG---PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP G PPP G PP P P PPPPP PP Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPP---PPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXX--GPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP G P GPPP P PPPPPP P Sbjct: 174 PPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 224 Score = 29.1 bits (62), Expect = 5.9 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 +P P PPP + PPP G P PPPPP PP Sbjct: 132 APPPKNSSPPPP---FGAPPPPDRGGQLAKKPSQG---SFPPPPPMGKPP 175 Score = 29.1 bits (62), Expect = 5.9 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXG--GPXXXFXXGXPPPPPPXXPP 792 PP G P PPPG PP GP G PPPP PP Sbjct: 232 PPTGSSRPLP-----APPPGENRPPPPMRGPTSG---GEPPPPKNAPPP 272 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 +P PP PP PPPG P GGP PPPPP PP Sbjct: 252 APPPPPISKPPTSTRSAPPPPPGRAPQPLGGP--------PPPPPGRRPP 293 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP 777 P PP PPP PPP P G P F PP PP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPP----PTRGPPSNSFTTQGPPLPP 214 Score = 31.9 bits (69), Expect = 0.83 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 SP PP G PPP P G P P G PPPP P Sbjct: 51 SPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPP-----MGKPPPPSGNKP 94 Score = 31.9 bits (69), Expect = 0.83 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP 777 +P PP PP F GPP P PPPPP Sbjct: 191 NPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPP 235 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +1 Query: 646 PXPPXGG---PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP G PPP G PP P P PPPPP PP Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPP---PPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXX--GPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP G P GPPP P PPPPPP P Sbjct: 86 PPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 136 Score = 29.1 bits (62), Expect = 5.9 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 +P P PPP + PPP G P PPPPP PP Sbjct: 44 APPPKNSSPPPP---FGAPPPPDRGGQLAKKPSQG---SFPPPPPMGKPP 87 Score = 29.1 bits (62), Expect = 5.9 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXG--GPXXXFXXGXPPPPPPXXPP 792 PP G P PPPG PP GP G PPPP PP Sbjct: 144 PPTGSSRPLP-----APPPGENRPPPPMRGPTSG---GEPPPPKNAPPP 184 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P GGPPP P P G PPPPPP PP Sbjct: 159 PATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPP 774 SP PP GGPPP PPP PP P PPPP Sbjct: 187 SPPPPSGGPPP--------PPP---PPPPPPPPPILELAAPPPP 219 Score = 32.7 bits (71), Expect = 0.48 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPP-----GXGXPPXGGPXXXFXXGXPPPPP 777 +P PP PPP PPP G PP P G PPPPP Sbjct: 123 APSPP---PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXP----PXGGPXXXFXXGXPPPPPPXXP 789 +P PP P PPP P P P G PPPPPP P Sbjct: 107 APTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 37.5 bits (83), Expect = 0.017 Identities = 22/50 (44%), Positives = 23/50 (46%), Gaps = 7/50 (14%) Frame = +1 Query: 652 PPXGG----PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPP---PPP 780 PP GG PPP + PPP PP GP F G PPP PPP Sbjct: 460 PPPGGMRGMPPPPMGMY---PPPRGFPPPPFGPPPPFYRGPPPPRGMPPP 506 Score = 35.5 bits (78), Expect = 0.068 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXP----PPPPPXXPP 792 PP PPP PP G PP G P F P PPPP PP Sbjct: 455 PPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPP 505 >SB_49249| Best HMM Match : RRM_1 (HMM E-Value=0.00042) Length = 792 Score = 36.3 bits (80), Expect = 0.039 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPX--GGPXXXFXXGXPPPPPPXXPP 792 P P GGP GPP G PP GGP P P PP PP Sbjct: 228 PMDP-GGPRMDHPMGHGGPPMDRGGPPMMHGGPGPRMPHSGPEPVPPGGPP 277 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 35.1 bits (77), Expect = 0.089 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 667 PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 PPP PPP PP G P G PPPPP P Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPK---FMGLPPPPPGMRP 1261 Score = 30.3 bits (65), Expect = 2.5 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 8/58 (13%) Frame = +1 Query: 643 SPXPPXGG------PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXP--PPPPPXXPP 792 +P PP G PPP GPP G PP P PPPP PP Sbjct: 1221 APRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPP 1278 Score = 28.7 bits (61), Expect = 7.8 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXP--PPPPPXXPP 792 P PP PP + PPP G P P F P PP P PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMP-PQPPFMPPPPRMQPPGPPGPP 1284 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.1 bits (77), Expect = 0.089 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGG---PXXXFXXGXPPPPPP 780 PP PPP PPP P G P G PPPPPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 33.1 bits (72), Expect = 0.36 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 698 APPRXGXPPXGXAPXGXFXXGXPPPPPRXAP 790 A P G PP P G G PPPPP P Sbjct: 654 ATPEAGPPPPPPPPPGGQAGGAPPPPPPPLP 684 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 35.1 bits (77), Expect = 0.089 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PPP G P P PPPPPP PP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 +P PP PPP PPP PP G P PPPPPP PP Sbjct: 289 APVPP---PPPADGSAPAPPPP---PPPGGAP-------PPPPPPPPPPP 325 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXG--XPPXGGPXXXFXXGXPPPPPP 780 P PP G P PPPG PP P G PPPPPP Sbjct: 293 PPPPADGSAPAPP---PPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 P PP G PPP PPP PP G PPPPPP Sbjct: 307 PPPPGGAPPP--------PPPPPPPPPGDG------GAPPPPPPP 337 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 35.1 bits (77), Expect = 0.089 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP PPP PP P PPP PP PP Sbjct: 152 PNPPY--PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 652 PPXGGPPPXXXF--WXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 PP PPP + PPP PP P P PPPP P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Score = 33.1 bits (72), Expect = 0.36 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 P PP PPP + PPP PP P P PP P P Sbjct: 103 PPPPPYPPPPNPPY---PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAP 147 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 P PP PPP P P PP P P PPPP P Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAP 202 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 SP PP PPP + P P PP P PPP PP PP Sbjct: 89 SPNPPYP-PPPYPPYPPPPPYPPPPNPPYPPPPNA--PYPPPPNPPYPPP 135 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +1 Query: 646 PXPPXGGPP-PXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 P PP PP P PPP PP P PPPP P Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Score = 31.5 bits (68), Expect = 1.1 Identities = 24/102 (23%), Positives = 24/102 (23%), Gaps = 1/102 (0%) Frame = +1 Query: 487 PPXXXPPXPXXXXXXXXXXXXXXXXXXXXXXXPPXXXXXXXXXXXXXXXXVXSPXPPXGG 666 PP PP P PP P PP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Query: 667 PP-PXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 PP P PPP PP P P PP P P Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 +P PP PPP + PPP PP PPP PP PP Sbjct: 172 APYPPPPYPPPPNPPYP--PPPNPPYPPPPNAP-----NPPPPNPPYPPP 214 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 P PP PPP PPP PP P PPPP P Sbjct: 98 PYPPYPPPPPYP------PPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPX--GGPXXXFXXGXPPPPPPXXPP 792 PP P P PPP PP P P PPPP PP Sbjct: 134 PPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 PP P P PPP PP P PPPP P Sbjct: 197 PPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 29.9 bits (64), Expect = 3.4 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 643 SPXPPXGGPP-PXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPP-PPPXXPP 792 +P PP PP P P P PP P PPP PPP P Sbjct: 122 APYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAP 173 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 646 PXPPXGGPP-PXXXFWXXGPPPGXGXPPX-GGPXXXFXXGXPPPPPPXXPP 792 P PP PP P PPP PP P + P PP PP Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 29.1 bits (62), Expect = 5.9 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 646 PXPPXG--GPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PPP + PPP PP P + PPP PP PP Sbjct: 117 PPPPNAPYPPPPNPPY---PPPPNAPYPP--SPNAPY---PPPPNPPYPPP 159 Score = 28.7 bits (61), Expect = 7.8 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PP P P PPP PP P PPP PP Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPP 164 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 35.1 bits (77), Expect = 0.089 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 661 GGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP 777 GGPPP GPPP G P G PPPP Sbjct: 501 GGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPP 539 Score = 35.1 bits (77), Expect = 0.089 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 661 GGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP 777 GGPPP GPPP G P G PPPP Sbjct: 534 GGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPP 572 Score = 33.9 bits (74), Expect = 0.21 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +1 Query: 646 PXPPX----GGPPPXXXFWXXG-PPPGXGXPPXGGPXXXFXXGXPPPP 774 P PP GGPPP G PPPG G G P G PPPP Sbjct: 536 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQG-GGPPPPGAGQGGPPPP 582 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 779 GGGGGGXPXXXXXXGPPXGGXPXPGG---GPXXQXKXXGGGPPXGGXG 645 G G GG P G GG P PG GP GGGPP G G Sbjct: 562 GAGQGGGPPPP---GAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAG 606 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 661 GGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP 777 GGPPP PPPG G G P G PPPP Sbjct: 567 GGPPPPGAGQGGPPPPGAG--QEGPPPPGAGQGGGPPPP 603 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = +1 Query: 646 PXPPX----GGPPPXXXFWXXG-PPPGXGXPPXGGPXXXFXXGXPPPPP 777 P PP GGPPP G PPPG G G P G PPPP Sbjct: 503 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQG-GGPPPPGAGQGGGPPPP 550 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -1 Query: 779 GGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 G GGG P GPP G G P + G PP G G Sbjct: 564 GQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQG 608 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = +1 Query: 646 PXPPX---GGPPPXXXFWXXGPPPG---XGXPPXGGPXXXFXXGXPPP 771 P PP GGPPP PPPG G PP G + G PPP Sbjct: 569 PPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGW--GLPPP 614 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 788 GXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 G GGG P GPP G G G GGGPP G G Sbjct: 496 GAGQGGGPPPPGAGQGGGPPPPGA-GQGWGQPPPGAGQGGGPPPPGAG 542 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 788 GXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 G GGG P GPP G G G GGGPP G G Sbjct: 529 GAGQGGGPPPPGAGQGGGPPPPGA-GQGWGQPPPGAGQGGGPPPPGAG 575 Score = 29.9 bits (64), Expect = 3.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 788 GXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXG 654 G GGG P G P G GGGP GG PP G Sbjct: 540 GAGQGGGPPPPGAGQGWGQPPPG-AGQGGGPPPPGAGQGGPPPPG 583 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 776 GGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 G GG P GPP G GGGP G G P G G Sbjct: 575 GQGGPPPPGAGQEGPPPPG-AGQGGGPPPPGAGQGWGLPPPGSG 617 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +3 Query: 660 GGPPPXXLXLXPGPPP-----GXGXPPXGXPXXG 746 GGPPP GPPP G G PP G G Sbjct: 501 GGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGG 534 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 788 GXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXG 654 G GGG P G P G GG P GG PP G Sbjct: 507 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPG 551 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +3 Query: 660 GGPPPXXLXLXPGPPP-----GXGXPPXGXPXXG 746 GGPPP GPPP G G PP G G Sbjct: 534 GGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGG 567 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 35.1 bits (77), Expect = 0.089 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGG GG G GG GGG + GGG GG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGG 1808 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGGGGG G GG GGG GGG GG G Sbjct: 1756 GGFGGGGGGGG--MGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGG 1802 Score = 29.9 bits (64), Expect = 3.4 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGGGG G GG GGG GGG GG G Sbjct: 1771 GGMAGGGGGMGGGGMAAGGGEFGGGEGMGGG----GMAGGGGGMGGGGG 1815 Score = 28.7 bits (61), Expect = 7.8 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG G GGGG G GG G G G G GG G Sbjct: 1793 GGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAG 1841 Score = 28.7 bits (61), Expect = 7.8 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGGGG G G GGG + GGG GG G Sbjct: 1800 GGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGE--GGGAGGGGGG 1846 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPP--PPPPXXPP 792 +P P GPPP GPPP G P P G PP PPP PP Sbjct: 2132 APARPAMGPPPMGSS-RYGPPPPMG-PARHSPSGPSPLGAPPSVPPPMGAPP 2181 Score = 32.3 bits (70), Expect = 0.63 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = +1 Query: 643 SPXPPXGGPP---PXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 S PP G PP P GPPP G PP G P PPP P Sbjct: 2172 SVPPPMGAPPSGPPPMGAPPSGPPP-MGTPPSGHPPMGAPPMGPPPSGSHSP 2222 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 663 GPPPXXLXLXPGPPPGXGXPPXGXPXXGXXXRG 761 GPPP + P PP G PP G P G G Sbjct: 2183 GPPP--MGAPPSGPPPMGTPPSGHPPMGAPPMG 2213 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 660 GGPP--PXXLXLXPGPPPGXGXPPXGXPXXGXXXRG 761 G PP P + P PP G PP G P G G Sbjct: 2168 GAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSG 2203 Score = 28.7 bits (61), Expect = 7.8 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 701 PPRXGXPPXGXAPXGXFXXGXPP--PPPRXAP 790 PP G PP G P G G PP PP P Sbjct: 2184 PPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPP 2215 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PPP PP P PPPPPP PP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGGGGG GG GGG GGG GG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 33.5 bits (73), Expect = 0.27 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGG 651 GG GGGGGG G G GGG GGG GG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 779 GGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GGGGGG G GG G G GGG GG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGGGGG G G G G GGG GG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = +1 Query: 646 PXPPXGGPP--PXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP GG P P + G P PP GG + G PPPPP P Sbjct: 604 PSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGG----YPTGQHPPPPPAGYP 650 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 788 GXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 G GGGGGG G GG GGG GGG GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 31.9 bits (69), Expect = 0.83 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 G GGGGGG G GG GGG GGG G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXG 654 GG GGGGGG G GG GGG G G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 29.9 bits (64), Expect = 3.4 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGGGGG G GG GGG G G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 29.1 bits (62), Expect = 5.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -1 Query: 788 GXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 G G GGGG G GG GGG GGG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 >SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) Length = 796 Score = 34.3 bits (75), Expect = 0.16 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 5/54 (9%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXG-----GPXXXFXXGXPPPPPPXXPP 792 P PP G PPP GP G PP G GP G P P P PP Sbjct: 362 PRPPMGPPPPPGFNLHTGPRLHMGPPPSGFHAQRGPQPEM--GPTPQPHPYVPP 413 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.21 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 SP PP PP PPP P P PPPPP PP Sbjct: 49 SPPPPPPSPPAAAP---AAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 8/57 (14%) Frame = +1 Query: 646 PXPPXGGP--PPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPP------PPXXPP 792 P PP P PP PPP PP P PPPP PP PP Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPP-PAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 33.9 bits (74), Expect = 0.21 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGGG G G GG GGG GGG GG G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 33.1 bits (72), Expect = 0.36 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 788 GXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 G GGGGGG G GG GGG GGG GG G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Score = 32.7 bits (71), Expect = 0.48 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPG-GGPXXQXKXXGGGPPXGGXG 645 GG GGGGGG G GG G GG GGG GG G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 32.7 bits (71), Expect = 0.48 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGGGGG G GG GGG G G G G Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 32.3 bits (70), Expect = 0.63 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG G GGGG G GG GG GGG GG G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GG GGG G GG GGG GG GG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGG 651 GG GGGGGG G G GGG GGG GG Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGG GG G G GGG GGG GG G Sbjct: 819 GGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGG 867 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG G GGG G GG GGG GGG GG G Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGGGG G GG G G GGG GG G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGG 865 Score = 29.9 bits (64), Expect = 3.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 779 GGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GGGGGG G GG GGG GGG G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGG 813 Score = 29.1 bits (62), Expect = 5.9 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGG 651 GG GGGG G G GG GGG GG GG Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 29.1 bits (62), Expect = 5.9 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 G GGGGGG G G GG GGG GG G Sbjct: 810 GDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGP-----PPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP PP W P PPG PP G P G P P P PP Sbjct: 1797 PGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPP-GPPGPQGPKGWPGVPGPPGPP 1849 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 993 PAGRXRDXXPPPPXGGXRXGGXPGXPXPXG 904 P GR PP GG G PG P P G Sbjct: 1864 PPGRDGIPGPPGRQGGKGPAGIPGIPGPGG 1893 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 33.5 bits (73), Expect = 0.27 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPP--GXGXPPXGGPXXXFXXGXPPPPPPXXP 789 +P PP PPP G P G PP P G PPP PP P Sbjct: 683 APPPPAPPPPPIGG----GDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPP 729 Score = 32.3 bits (70), Expect = 0.63 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP GG P W G PP PP PPPP P PP Sbjct: 690 PPPPIGGGDPT--IWVSGGPP-LSAPPLSSTLG------PPPPAPPPPP 729 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.1 bits (72), Expect = 0.36 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXP--PXGGPXXXFXXGXPPPPPPXXPP 792 PP PP F PP P P P F PPPP PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 32.7 bits (71), Expect = 0.48 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -1 Query: 791 GGXXGGG-GGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGG GGG G GG GGG GGG GG G Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 32.3 bits (70), Expect = 0.63 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGG GG G GG GGG GGG GG G Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYG 177 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGG GG G GG GGG GGG GG G Sbjct: 174 GGYGGGGYGGGGHGGGGYG--GGGYGGGGGGYGGSGYGGGGGYGGGGYG 220 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 32.7 bits (71), Expect = 0.48 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXF------XXGXPPPPPPXXPP 792 P P GPP PPPG G PP P + G PP PPP P Sbjct: 130 PYPGAAGPPMPHPTASVYPPPG-GYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYP 183 Score = 28.7 bits (61), Expect = 7.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 655 PXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPP---PPPXXPP 792 P G PPP P PG PP P PPP PP PP Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASV---YPPPGGYPPTSYPP 160 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 32.7 bits (71), Expect = 0.48 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +1 Query: 637 VXSPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 + P PP PPP PPP PP P PPPPPP PP Sbjct: 201 ITQPPPPPPRPPP-------SPPP---PPPPPSPSPP----RPPPPPPPSPP 238 Score = 32.3 bits (70), Expect = 0.63 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP-PXXPP 792 P PP PPP PP PP P P PPP P PP Sbjct: 209 PRPPPSPPPPPPP--PSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 32.3 bits (70), Expect = 0.63 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPP 780 P G PP P F G PPPPPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPP 216 Score = 32.3 bits (70), Expect = 0.63 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPP 768 PP PPP F PPP PP G P G PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPP--PPFGAPPPPALNGGPP 231 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPP 774 P P G PPP PPP G P P G PPPP Sbjct: 188 PSPMAGMPPPPP------PPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 31.9 bits (69), Expect = 0.83 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 655 PXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P GPP G P G G PP GP G P P PP P Sbjct: 74 PPRGPPRGHPMRGRGAPYGRGGPPSRGP----PRGPPLPGPPRRGP 115 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 31.9 bits (69), Expect = 0.83 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 PP PP P F PPPPPP P Sbjct: 290 PPAVVTAPPPAPPLPNFTSPSPPPPPPLPP 319 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PPP P P PPPPP PP Sbjct: 289 PPPAVVTAPPPAPPLPNFTSPSPPPPPPLPP 319 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 31.1 bits (67), Expect = 1.5 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GG GG P G GG P GG P G G GG G Sbjct: 180 GGMPGGMPGGMPGGFPGAGGMPGGFPGAGGMPGG---FPGAGGMPGGPG 225 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXP--XPGGGPXXQXKXXGGGPPXGGXG 645 GG GG GG P P GG P PG G GG P G G Sbjct: 176 GGFPGGMPGGMPGGMPGGFPGAGGMPGGFPGAGGMPGGFPGAGGMPGGPGG 226 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXF-XXGXPPPPPPXXPP 792 PPPG PP G P G P PPP PP Sbjct: 217 PPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPP 248 Score = 29.1 bits (62), Expect = 5.9 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 646 PXPPXG-GPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 P P G PPP G PPG PP G P F P PPPP Sbjct: 209 PNAPPGLMPPPGMLPPPGGMPPGR-MPPQGLP---FPPPGPIPPPP 250 >SB_31319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1186 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPP 768 P P GGP P GP PG G P G P F G PP Sbjct: 522 PDPGLGGPNPGLG----GPNPGLGGPNPGTPDSGF-GGSPP 557 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.1 bits (67), Expect = 1.5 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = -1 Query: 791 GGXXGGG----GGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGG GGG G GG GGG GGGP GG G Sbjct: 314 GGATGGGGGATGGGVGATGGGGGATGGGGGVTGGG--GGATGGGGGPGSGGCG 364 Score = 29.9 bits (64), Expect = 3.4 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXGXXT 636 GG G GGG G GG GGG GGG GG G T Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGG---GGATGGGGGATGGGGGAT 296 Score = 29.9 bits (64), Expect = 3.4 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXGXXT 636 GG G GGG G GG GGG GGG GG G T Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGG---GGATGGGGGATGGGGGAT 303 Score = 29.9 bits (64), Expect = 3.4 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXGXXT 636 GG G GGG G GG GGG GGG GG G T Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGG---GGATGGGGGATGGGGGAT 310 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXGXXT 636 GG GGGGG G GG GGG GGG GG G T Sbjct: 244 GGATGGGGGA---TGGGGGATGGGGGATGGG---GGATGGGGGATGGGGGAT 289 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXGXXT 636 GG GGGGG G GG GGG GGG GG G T Sbjct: 300 GGATGGGGGA---TGVGGGATGGGGGATGGG---VGATGGGGGATGGGGGVT 345 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PPP PP P PPPPPP PP Sbjct: 1159 PPPPPPPPPPSSP------SPPPPPPPPPPP 1183 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P P GGPPP F P PP GP G P P PP Sbjct: 221 PGMPPGGPPP---FPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPP 266 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 667 PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 PPP F+ PP PP P F PPPPPP Sbjct: 52 PPPPPRFYDNDIPP----PPP--PRRGFYDDYPPPPPP 83 >SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) Length = 351 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 776 GGGGGXPXXXXXXGPPXGGXPX--PGGGPXXQXKXXGGGPPXGGXG 645 GGGGG P G GG P PGGG K G P G G Sbjct: 18 GGGGGSPTEAPGGG---GGSPTEAPGGGGSTPTKGEGSTSPTPGGG 60 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 664 GPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 G PP PP PP P G PPPPP Sbjct: 267 GHPPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPP 305 Score = 28.7 bits (61), Expect = 7.8 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +1 Query: 646 PXPPXGGPP---PXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP 777 P PP P F PPP PP P PPPPP Sbjct: 283 PPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPG-XGXPPXGGPXXXFXXGXPPPPPPXXP 789 P G P P GPP G G PP GGP G P PP P Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRG-PMGPGPGMPPMRP 446 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGP 696 GG G G GG P P GG GGP Sbjct: 709 GGAGGAGAGGMPGGMPGGRPTPGGGDAESGGP 740 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.5 bits (63), Expect = 4.4 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXG-PPPGXGXPPXGGPXXXF----XXGXPPP---PPP 780 PP GPPP G PPP P P F G PPP PPP Sbjct: 279 PPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPPP 329 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 697 GPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 G G G P P PPPPPP PP Sbjct: 455 GDTEGVGQAPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 29.1 bits (62), Expect = 5.9 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPP 780 +P PP PPP PPP PP P PPPPPP Sbjct: 463 APPPPPPPPPPP-------PPPPPPPPPPPPP-------FPPPPPP 494 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PPP PP P PPP PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPP 777 PPPG G P P G PPPPP Sbjct: 198 PPPGPGGIPP--PPPPIRGGVPPPPP 221 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PP G PP G P G P PPP P Sbjct: 231 PPQGYAPPPGGYPGAPPAGGYPGAPPPGGYP 261 Score = 29.1 bits (62), Expect = 5.9 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +1 Query: 667 PPPXXXFWXXGPPPGX--GXPPXGG-PXXXFXXGXPPPPPPXXPP 792 PPP PPPG G PP GG P G P PPP P Sbjct: 230 PPPQGY----APPPGGYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +1 Query: 667 PPPXXXFWXXGPPPGXGXP--PXGGPXXXFXXGXPPPPPPXXPP 792 PPP + PPPG P P G P G PP PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPP 72 Score = 29.1 bits (62), Expect = 5.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPP----PXXPP 792 P PP PP GPP G GP PP PP P PP Sbjct: 72 PGPPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPP 124 Score = 29.1 bits (62), Expect = 5.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXP----PXGGPXXXFXXGXPPPPPPXXPP 792 P P G P P GPP G P P G G P P P PP Sbjct: 257 PQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 309 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 966 PPPPXGGXRXGGXPGXPXPXG 904 PPPP G G PG P P G Sbjct: 38 PPPPPGPPGPDGPPGFPGPQG 58 Score = 28.7 bits (61), Expect = 7.8 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 SP P G P P GP G P GP P PP P Sbjct: 887 SPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQPAPPCPP 935 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGG 699 GG GGGGGG G GG GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGG 699 GG GGGGGG G GG GGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGG 699 GG GGGGGG G GG GGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGG 699 GG GGGGGG G GG GGG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGG 699 GG GGGGGG G GG GGG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 29.1 bits (62), Expect = 5.9 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 +P PP PPP PP PP P PPPPPP P Sbjct: 776 APPPP---PPPTKPATPRVPPNIPSRPPGARPT-------PPPPPPGKP 814 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 703 PPGXGXPPXGGPXXXFXXG--XPPPPPPXXP 789 PPG G P G P G P PPPP P Sbjct: 376 PPGAGNGPGGPPPPWSKPGGILPGPPPPGPP 406 Score = 29.1 bits (62), Expect = 5.9 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 8/57 (14%) Frame = +1 Query: 646 PXPPXGGPP-----PXXXFWXXGP---PPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 P PP GPP P W P PP PP G P PPPPPP P Sbjct: 398 PGPPPPGPPMLNMAPSIPPWQTTPGYIPP----PPPGFPQFQ----PPPPPPPSDAP 446 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 779 GGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GGGGGG G G G G GGG GG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 29.1 bits (62), Expect = 5.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 655 PXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXF--XXGXPPP---PPPXXPP 792 P PPP G P PP P F G P P PPP PP Sbjct: 493 PVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPP 543 Score = 29.1 bits (62), Expect = 5.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 655 PXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXF--XXGXPPP---PPPXXPP 792 P PPP G P PP P F G P P PPP PP Sbjct: 515 PPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPP 565 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.1 bits (62), Expect = 5.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PPPG PP P PPP PP P Sbjct: 557 PPPGVDIPPPLPPSEDPKPPPPPPEPPEECP 587 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 29.1 bits (62), Expect = 5.9 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQ--XKXXGGGPPXGGXGXXT 636 GG GGGGG GG GGG GGG GG G T Sbjct: 58 GGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGAT 111 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 667 PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PP PPP PP P PPPPPP P Sbjct: 215 PPEPDYLEPTPPPPAAPAPP---PPPAAAPPPPPPPPPVKKP 253 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGG 699 GG GGGGGG G GG GGG Sbjct: 762 GGGYGGGGGGYRGGGGYGGGHRGGGGYGGGG 792 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 29.1 bits (62), Expect = 5.9 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPP 771 P PP G P + GPP G PP PPP Sbjct: 838 PPPPPQGYEPQPQYQPQGPPQYYGGPPPQQQQQRQPQSGPPP 879 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 28.7 bits (61), Expect = 7.8 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 652 PPXGGPPPXXXFWXXGPPPGXGXP-PXGGPXXXFXXGXPPPPPPXXPP 792 PP PP F GPP G P P GP G P P PP Sbjct: 25 PPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYP--SSGYPTSVPGAAPP 70 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 706 PGXGXPPXGGPXXXFXXGXPPPPPP 780 P PP G G PPPPPP Sbjct: 192 PSWNRPPPSGAPPPPPIGAPPPPPP 216 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 28.7 bits (61), Expect = 7.8 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = -1 Query: 791 GGXXGGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQ--XKXXGGGPPXGGXGXXT 636 GG GGG GG G GG GGG GGG G T Sbjct: 143 GGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAGAT 196 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 28.7 bits (61), Expect = 7.8 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 P P GG PP PPPG G P P G P PP P P Sbjct: 645 PNPFFGGIPP--------PPPGGGMFPPPPPPPP-GGGVPGPPKPPPP 683 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 28.7 bits (61), Expect = 7.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 779 GGGGGGXPXXXXXXGPPXGGXPXPGGGPXXQXKXXGGGPPXGGXG 645 GG GGG G GG GGG GGG GG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = +1 Query: 646 PXPPXGGPPPXXXFWXXGPPPG---XGXPPXGGPXXXFXXGXPPP--PPPXXPP 792 P P G PP PPP G PP P G PPP P P PP Sbjct: 45 PNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTP----IPGDPPPNTPIPGNPP 94 >SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) Length = 713 Score = 28.7 bits (61), Expect = 7.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 667 PPPXXXFWXXGPPPGXGXPPXGGPXXXFXXGXPPPPPPXXP 789 PPP P PP GGP G PP PP P Sbjct: 490 PPPSDAMMQGMGAPSMSEPPAGGP----PMGQGPPRPPTNP 526 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 23.4 bits (48), Expect(2) = 9.7 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +1 Query: 643 SPXPPXGGPPPXXXFWXXGPPPGXGXPP 726 +P P PPP PPP PP Sbjct: 900 TPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 23.0 bits (47), Expect(2) = 9.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 700 PPPGXGXPPXGGPXXXFXXGXPPPPPPXXPP 792 PPP PP P PP PP PP Sbjct: 952 PPPTSALPPPI-PATQVPPPPLPPLPPPPPP 981 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,713,238 Number of Sequences: 59808 Number of extensions: 251850 Number of successful extensions: 3775 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2068 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2967383049 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -