BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F13 (843 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) 179 3e-45 SB_54647| Best HMM Match : Phage_tail_S (HMM E-Value=2.4) 33 0.38 SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_10798| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) 29 6.2 SB_23672| Best HMM Match : PHD (HMM E-Value=0.00049) 28 8.2 >SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 179 bits (435), Expect = 3e-45 Identities = 78/167 (46%), Positives = 122/167 (73%) Frame = +1 Query: 196 ISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFYERAEVTPPEDDPK 375 +S+RL+SVKNIQKIT+SMKMVSAAK+ RAE++LK+AR YG+GA Y++ E+ +DPK Sbjct: 62 VSLRLRSVKNIQKITKSMKMVSAAKFGRAEKELKSARAYGDGATALYDKVEIKQESEDPK 121 Query: 376 QLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGAENIKVICVGDKSRGILQRLYGKHIISV 555 L V ++SDRGLCG +H+G++K ++ ++ + N+ ++ GDK++ IL R GK+++ Sbjct: 122 HLIVVLSSDRGLCGGIHSGLAKAVKASIAGNPSRNVGIVSFGDKTKQILSRTLGKNMLMS 181 Query: 556 ANEIGRLPPTFLDASQLATAILTSGYEFGSGKIIYNKFKSVVSYAQS 696 ++G+ PP F +A+ LA IL +G++F +G + YN F+SVVS+ S Sbjct: 182 FMDVGKKPPLFCEATFLAQEILDAGFDFNTGDMFYNVFRSVVSFRAS 228 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/37 (43%), Positives = 28/37 (75%) Frame = +2 Query: 731 SASKLTAYDSLDSDVLQSYTEFSLASLLFYALKXGPC 841 ++ +++YD LDS+V++ Y EF+LAS+LF+ +K C Sbjct: 242 ASDSMSSYDELDSEVIRCYQEFNLASMLFFGMKEQSC 278 >SB_54647| Best HMM Match : Phage_tail_S (HMM E-Value=2.4) Length = 571 Score = 32.7 bits (71), Expect = 0.38 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 7/95 (7%) Frame = +1 Query: 370 PKQLFVAMTSDRG-LCGAVHTGVSKV------IRNRLSEPGAENIKVICVGDKSRGILQR 528 P++LF+ S G + AV+TG+S+V +R + IK + D+ +G + Sbjct: 447 PRRLFIIDHSLEGWITNAVYTGISRVRLAGQIVRVIPPDDTPARIKRYAIDDRQKGRTKY 506 Query: 529 LYGKHIISVANEIGRLPPTFLDASQLATAILTSGY 633 H+++V N +G + + T +L GY Sbjct: 507 TGPHHVLTVDNVLGMIADAEKKYTLCGTQLLLQGY 541 >SB_56228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 6/94 (6%) Frame = +1 Query: 370 PKQLFVAMTSDRG-LCGAVHTGVSKVIRNRLSEPGAEN-----IKVICVGDKSRGILQRL 531 P++LF+ + G + AV+TG+ +V RL +E IK + D+ +G + Sbjct: 842 PRRLFIIDHNLEGWIANAVYTGIFRV---RLQATPSEELIIARIKRYAIDDRQKGRTKYT 898 Query: 532 YGKHIISVANEIGRLPPTFLDASQLATAILTSGY 633 H+++V + +G + T + +L GY Sbjct: 899 GSHHVLTVDHVLGMIAETEKKCTVCGAQLLLQGY 932 >SB_10798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 28.7 bits (61), Expect = 6.2 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 10/98 (10%) Frame = +1 Query: 370 PKQLFVAMTSDRG-LCGAVHTGVSKVIRN----RLSEPGAEN-----IKVICVGDKSRGI 519 P++LF+ S G + AV+TG+S+V R++ P + IK + D+ +G Sbjct: 754 PRRLFIIDHSLEGWITNAVYTGISRVRHTDQIVRVTPPPPPDNTPARIKRYAIDDRQKGR 813 Query: 520 LQRLYGKHIISVANEIGRLPPTFLDASQLATAILTSGY 633 + H+++V + +G + + T L GY Sbjct: 814 TKYTGSHHLLTVYHVLGMIADAEKKCTVCGTQRLLQGY 851 >SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) Length = 1050 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 258 HHLHGLCDFLDIFHRFKTDGNGLQSSHIPVWL 163 +H+ C+ + F+R + G G H+ VWL Sbjct: 595 NHIRNRCNVENFFYRIEFQGRGTAHVHLLVWL 626 >SB_23672| Best HMM Match : PHD (HMM E-Value=0.00049) Length = 370 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = -1 Query: 564 LISNTNDVLSVQSLQDTARFISHTDHLDVLSTRFAETVADHFRYTSVYSSAQTSVRGHSN 385 LI N DV +D+ + HTD+ V +R E V DH T+ + + S + S+ Sbjct: 62 LIRNNADVDEGME-EDSQMPLDHTDNTPVTHSREFEAVDDHTPPTTPTETTRKSAKRQSD 120 Query: 384 KQ 379 Q Sbjct: 121 SQ 122 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,760,681 Number of Sequences: 59808 Number of extensions: 639500 Number of successful extensions: 1763 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1760 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -