BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F13 (843 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 23 3.5 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 23 3.5 AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced prot... 23 4.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 8.1 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 23.0 bits (47), Expect = 3.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 117 LRTGCGHPSRGGGLPSAKQ 173 L + C PSRG +PS+++ Sbjct: 12 LLSSCTRPSRGNAVPSSQR 30 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 23.0 bits (47), Expect = 3.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 117 LRTGCGHPSRGGGLPSAKQ 173 L + C PSRG +PS+++ Sbjct: 12 LLSSCTRPSRGNAVPSSQR 30 >AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced protein 75 protein. Length = 36 Score = 22.6 bits (46), Expect = 4.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 545 MCFPYNLCRIPRDLSPTQITL 483 M PY++ ++P LSP T+ Sbjct: 1 MSSPYHVAQLPHHLSPNMPTM 21 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 8.1 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = -1 Query: 438 RYTSVYSSAQTSVRGHSNKQLLGVIFGRCNLSPFIELYCTFTIGTSS 298 RY++ SSA T+ S + + C+ + ++ + T TI S+ Sbjct: 921 RYSTTKSSAVTATNASSMIAPVALTAATCDQNKAVKKHITTTIDCST 967 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,244 Number of Sequences: 438 Number of extensions: 5545 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -