BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F11 (948 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 48 8e-06 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 42 7e-04 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 41 0.002 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 40 0.003 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 37 0.021 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 37 0.021 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 36 0.036 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.063 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 35 0.084 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 35 0.11 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 35 0.11 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 34 0.15 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 34 0.19 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 33 0.34 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 31 1.0 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 31 1.0 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 31 1.4 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 31 1.8 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.8 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.8 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 31 1.8 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 30 3.1 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 4.2 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 4.2 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 29 4.2 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 5.5 SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 28 9.6 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_46326| Best HMM Match : Scramblase (HMM E-Value=0) 28 9.6 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 28 9.6 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 48.4 bits (110), Expect = 8e-06 Identities = 25/58 (43%), Positives = 26/58 (44%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 GGG+P P G PPPP GG P PP P PP GG P P PPP Sbjct: 286 GGGAPVPPPPPADGSAP----APPPPPPPGGAPPPPP--PPPPPPPGDGGAPPPPPPP 337 Score = 35.1 bits (77), Expect = 0.084 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP G+ PP P PP GG P P PPP P P Sbjct: 292 PPPP----PADGSAPAPPPPPPP--GGAPPPPPPP-PPPPP 325 Score = 32.3 bits (70), Expect = 0.59 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +1 Query: 454 GVPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPP 627 G P PP G PPPP G G PPP P PG G P PP Sbjct: 288 GAPVPPPPPADGSAP---APPPPPPPG-----GAPPPPPP--PPPPPPGDGGAPPPPP 335 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP G P PP PP P P PPP P Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPP--PPPPPPPPPPGDGGAP 331 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP PPP PP P P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPP 320 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 9/36 (25%) Frame = -2 Query: 461 GTPXGPP---------XPXPPFXGGXPXPXPPPXXP 381 G P PP P PP GG P P PPP P Sbjct: 288 GAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPP 323 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXP 372 P P PP G P P PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAP 314 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPPP G G PPP PP P PG G P Sbjct: 306 PPPPPG-----GAPPPPPP----PPPPPPGDGGAPP 332 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/87 (32%), Positives = 29/87 (33%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTP 453 P G P PG GG +P P G PPPP GG Sbjct: 915 PGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNA-------PPPPPPPGGSAPPPG 967 Query: 452 XGPPXPXPPFXGGXPXPXPPPXXPXXP 372 G P PP G P P PPP P P Sbjct: 968 GGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 517 PPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PPPP G PPP P PG P PP G Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPG 960 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 472 PPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PP GG PPPP G PPP P PG G P PP G Sbjct: 934 PPPPGGSAP----SQPPPPGGN----APPPPPPPGGSAPP-PGGGAPPLPPPPG 978 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 472 PPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PP GG PPPP G PPP P PG G P PP G Sbjct: 923 PPPPGGNAPL-----PPPPPGGSAPSQPPPPGGNAPPPPPPPG-GSAP--PPGG 968 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 472 PPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPP 627 PP GG PPPP G PPP P PG P PP Sbjct: 945 PPPPGGNAP----PPPPPPGG-----SAPPPGGGAPPLPPPPGGSAPPPPPP 987 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP GG G P P P PP GG P PPP P Sbjct: 663 PPPPPPGGQAGGAP---PPPPPPLPGGAAPPPPPPIGGGAP 700 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -2 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGG 282 GPP P PP GG PPP P P PP PPP G G Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPPLPG------GAAPPPPPPIGGGAPPPPPPGFG 708 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +1 Query: 454 GVPXXXPPXRGG--GGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXG 606 G P PP GG GG PPPP PPP P PG G Sbjct: 659 GPPPPPPPPPGGQAGG---APPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFG 708 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 461 GTPXGPPXPXPPFXGGXPXPXPPP 390 G P PP P GG P P PPP Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPP 682 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 492 PPPPXXGXXXGDPGWAPXXLSPFFXGXAXXXPPP 391 PPPP G G AP P G A PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 PPPP G P PP P PP G P P PP P P F Sbjct: 727 PPPPSPQPGCAGLPP-PPPPPPPGCAGLPPPPPPIDVPMKPLF 768 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGG-XPXPXPPPXXP 381 PP P G P PP P PP G P P PPP P Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G P PP P P G P P PPP Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -2 Query: 518 GXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 G + PPPP GT PP P PP G P PPP Sbjct: 688 GSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXXP 267 PP P P G PPP P P PP PPP G P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPP---------PPPPPGCAGLPPP 728 Query: 266 XFXXXXFCLGTPP 228 C G PP Sbjct: 729 PPSPQPGCAGLPP 741 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 460 PXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 P PP G + PPPP G G PPP P G P PP G Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPG---CAGLPPP--PPSPQPGCAGLPPPPPPPPPG 749 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP +P PP P PP P P PPP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP+ P PP P PP P P PPP P P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P P PPP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P P PPP P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P P PPP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P P PPP P P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P P PPP P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P P P PP P P PPP P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P P P P PPP P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P PP P PP P P PPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P P PPP P P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPP-PPPPPPPPPPPPPPAPP 421 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXF 324 PPPP P PP P PP P PPP P P PP F Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRF 445 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP +P PP P PP P P PPP P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 35.1 bits (77), Expect = 0.084 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP P PP P PP P P PPP P P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 458 TPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 +P PP P PP P P PPP P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPP 392 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 473 GXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 G P PP P PP P P PPP P P Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPP 393 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = -2 Query: 494 PPPPRXGGXXX----GTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP GG G P P P PP G P P PPP P Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPP-PPLPAGVPAPPPPPPPP 322 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGG 414 PPPP G P PP P PP GG Sbjct: 304 PPPPLPAG----VPAPPPPPPPPMLGG 326 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 37.9 bits (84), Expect = 0.012 Identities = 34/125 (27%), Positives = 34/125 (27%), Gaps = 3/125 (2%) Frame = -2 Query: 647 WXXXXPXGGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGX 468 W P G G P PG G G P G G PPPP G Sbjct: 490 WGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGG-----GPPPPGAGQG 544 Query: 467 XXGTPXGPP---XPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPP 297 P G PP G P PP P PP G PP Sbjct: 545 GGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPG---AGQGGGPP 601 Query: 296 PXGGG 282 P G G Sbjct: 602 PPGAG 606 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 472 PPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PP G GG PPP G G PPP P PG G PP G Sbjct: 505 PPGAGQGGG-------PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPG 551 Score = 33.9 bits (74), Expect = 0.19 Identities = 35/123 (28%), Positives = 36/123 (29%), Gaps = 1/123 (0%) Frame = +1 Query: 268 GXXXXPPPXGGGXPXXXKKKXXX-GGXXXKKXXXKXGXXGXXGGGXGXGXXXXXXXXXXX 444 G PPP G G GG + G G G G G Sbjct: 509 GQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGG- 567 Query: 445 XXXGVPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXP 624 G P PP G GG PPPP G PPP P PG G P Sbjct: 568 ---GPP---PPGAGQGG-------PPPPGAGQE--GPPPPGAGQGGGPPPPGAGQGWGLP 612 Query: 625 PXG 633 P G Sbjct: 613 PPG 615 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 472 PPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PP G GG PPP G G PPP PG G PP G Sbjct: 494 PPGAGQGGG-------PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPG 540 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 523 PPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PP G G PPP P PG G PP G Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPG 529 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P P P PP G P P PP P P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP G P P P PP G P P PP P Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P P P PP G P P PP P P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 GGGG + PPPP P P PP P P PP P P Sbjct: 340 GGGG----VNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPP 387 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 517 PPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPP 627 PPPP PPP P P G P PP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP 408 PPPP G P P P PP G P Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -2 Query: 461 GTPXGPPXPXPP-FXGGXPXPXPPPXXPXXP 372 G P PP P PP F GG P P PPP P Sbjct: 193 GMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXP 402 PPP G P G P P PP G P P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXG---PPXPXPPFXGGXPXPXPPP 390 PP P GG P G PP P PP GG P P PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPP 426 P GGG F PPPP GG G P GPP P PP Sbjct: 655 PPPGGGMF---PPPPPPPPGG---GVP-GPPKPPPP 683 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 472 PPXRGGGGXFIXKKXPPPPXGXXXXXGXPPP 564 PP GGG F PPPP G PPP Sbjct: 653 PPPPPGGGMF-PPPPPPPPGGGVPGPPKPPP 682 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/67 (29%), Positives = 22/67 (32%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P P+ P PPP P P PP + Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP 176 Query: 314 XXGXPPP 294 PPP Sbjct: 177 PPYPPPP 183 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP+ P PPP P P Sbjct: 95 PPPPYP--PYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP 133 Score = 33.5 bits (73), Expect = 0.26 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP-PXXPXXPXFXXXFFXXXPPXXXFFX 318 P PP P PP P PP P P PP P P P PP + Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 Query: 317 XXXGXPPP 294 PPP Sbjct: 158 PPLYPPPP 165 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP-PXXPXXP 372 PPPP P PP P PP P P PP P P P Sbjct: 180 PPPPNP---PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP P P P PP+ P PPP P P Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYP 196 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P PP+ P P PPP P P Sbjct: 92 PPYPPPPYPPYP--PPPPYPPPPNPPYP 117 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P P PP P P+ P P PPP P P Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPY---PPPPYPPPPNPPYP 188 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P P PP P PP+ P PPP P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNP 204 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX---PXPPFXGGXPXPXPPPXXPXXPXF 366 PPPP P PP P PP+ P PP P P F Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQF 241 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPPP P PP P PP P P PP P P + PP Sbjct: 149 PPPPNP---PYPPPLYPPPPNPP-PPNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/46 (30%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFX---GGXPXPXPPPXXPXXPXF 366 PPPP PP P PP+ P PPP P + Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPY 233 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P P P PP P P PPP P P Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPP-PPNPPYP-PPPNAPNPP 205 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 36.3 bits (80), Expect = 0.036 Identities = 30/108 (27%), Positives = 31/108 (28%), Gaps = 8/108 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP----XXPXXPXF---XXXFFXXXPP 336 PPPP G G P PP G P PPP P P PP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPP 356 Query: 335 XXXFFXXXXGXPPPXGGGXXXXPXF-XXXXFCLGTPPXXXXXYKGGXP 195 PPP GG P LG PP +G P Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 Score = 34.3 bits (75), Expect = 0.15 Identities = 24/79 (30%), Positives = 25/79 (31%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXF 324 I+ PPPP G G P P PP G P P P P PP Sbjct: 285 IQPPPPPSRGAAPPPPSRGAPPP-PPSRGSAPPPPPARMGTAPPPPPPSRSSQRPP---- 339 Query: 323 FXXXXGXPPPXGGGXXXXP 267 G PPP G P Sbjct: 340 -PPSRGAPPPPSMGMAPPP 357 Score = 31.9 bits (69), Expect = 0.78 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP 396 GG +P P GG PPPP G + G P P PP G P P P Sbjct: 359 GGAAPPPPPPPPVGG------PPPPPPPIEGRPPSS-LGNPPPPPPPGRGAPPPGP 407 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/58 (25%), Positives = 17/58 (29%) Frame = +1 Query: 454 GVPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPP 627 G+ PP RG + PPPP PP P P PP Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = +1 Query: 472 PPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PP G + PPPP PPP + P G P PP G Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP--SSLGNPPPPPPPG 399 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.063 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P PP P PP P P PPP P Sbjct: 75 PPPP--AAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P PP PP P P PPP P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPP-PPPLPAPPPPPAQP 101 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 3/44 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP---PXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P P P PP P PPP P P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 35.1 bits (77), Expect = 0.084 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP---PXPXPPFXGGXPXPXPP 393 GG P P GG PPPP P P P PP G P P PP Sbjct: 149 GGPPPPPPIAPATGG------PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPP 202 Query: 392 PXXPXXP 372 P P P Sbjct: 203 PPPPPPP 209 Score = 33.5 bits (73), Expect = 0.26 Identities = 21/69 (30%), Positives = 22/69 (31%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFF 321 + PPPP G P PP P P GG P P P P PP Sbjct: 136 RAPPPPPPIAPATGGPPPPP-PIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGG 194 Query: 320 XXXXGXPPP 294 PPP Sbjct: 195 PPPPPPPPP 203 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPPR P PP P P P PPP P PP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSP--ATRAPPPPPPIAPAT--------GGPPPPPPIAPA 160 Query: 314 XXGXPPP 294 G PPP Sbjct: 161 TGGPPPP 167 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP 396 PPP GG P PP P PP P P Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G G P P PP G P PPP Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPP R G P PP PP P P PPP Sbjct: 359 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 PPPP G P PP P G P PPP P F Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSF 400 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXP 589 PPPP + G PPP PP + P Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPP 381 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF-XXXFFXXXPPXXXFFX 318 PPPP GG P P PP P PPP P F PP Sbjct: 147 PPPPDRGGQLAKKPSQGSFPPPP-----PMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSR 201 Query: 317 XXXGXPPP 294 PPP Sbjct: 202 HGSAPPPP 209 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P G G PPP P G P PP G PPP P Sbjct: 218 PPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP 271 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G G P P PP G P PPP Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPP R G P PP PP P P PPP Sbjct: 271 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 PPPP G P PP P G P PPP P F Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSF 312 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXP 589 PPPP + G PPP PP + P Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPP 293 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF-XXXFFXXXPPXXXFFX 318 PPPP GG P P PP P PPP P F PP Sbjct: 59 PPPPDRGGQLAKKPSQGSFPPPP-----PMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSR 113 Query: 317 XXXGXPPP 294 PPP Sbjct: 114 HGSAPPPP 121 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P G G PPP P G P PP G PPP P Sbjct: 130 PPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP 183 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 34.3 bits (75), Expect = 0.15 Identities = 25/76 (32%), Positives = 29/76 (38%), Gaps = 3/76 (3%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFX---GGXPXPXPPPXXPXXPXFXXXFFXXXPPX 333 ++ PPPP+ GPP P PP GG P P PP P P PP Sbjct: 425 MRLPPPPQH--------TGPPQPRPPHGMPQGGGP-PQLPPNLPPPPGGMRGM---PPPP 472 Query: 332 XXFFXXXXGXPPPXGG 285 + G PPP G Sbjct: 473 MGMYPPPRGFPPPPFG 488 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 P GGG PPPP G G P P PP G P P PP Sbjct: 446 PQGGGPPQLPPNLPPPP---GGMRGMPPPPMGMYPPPRGFPPPPFGPP 490 Score = 32.7 bits (71), Expect = 0.45 Identities = 25/69 (36%), Positives = 27/69 (39%), Gaps = 5/69 (7%) Frame = -2 Query: 563 GGGSPXXXXX-PXGGGGXFFXIKXPPPPRXG--GXXXGTPXGPPXPXPPFXGGXPXP--X 399 GGG P P GG ++ PPP G G P P P PPF G P P Sbjct: 448 GGGPPQLPPNLPPPPGG----MRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGM 503 Query: 398 PPPXXPXXP 372 PPP P Sbjct: 504 PPPPRQRMP 512 Score = 31.9 bits (69), Expect = 0.78 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP-PXXPXXPXFXXXFFXXXPPXXXFFX 318 P PP G P PP PP G P PP P F F PP Sbjct: 439 PRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPP 498 Query: 317 XXXGXPPP 294 G PPP Sbjct: 499 PPRGMPPP 506 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = +1 Query: 454 GVPXXXPPX---RGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXP 624 G P PP +GGG + PPPP G G PPP P G P P Sbjct: 435 GPPQPRPPHGMPQGGGPPQLPPNLPPPPGG---MRGMPPPPMGMYPPPR--GFPPPPFGP 489 Query: 625 P 627 P Sbjct: 490 P 490 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPPR P PP P PP P PPP P P Sbjct: 206 PPPPRP------PPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P PP P PP P P PPP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPP----RPPPPPPPSPP 238 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P PPP P Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP PPP PP P+ P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 443 PXPXPPFXGGXPXPXPPPXXPXXP 372 P P PP P P PPP P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPP 227 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP 396 PPPP G P G P P PP GG P P P Sbjct: 195 PPPPPPG------PGGIPPPPPPIRGGVPPPPP 221 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P PP P P PPP P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXP 381 P PP P PP P P PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P PP P PPP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -2 Query: 494 PPPPRXGGXXX-GTPXGPPXPXPPFXG--GXPXPXPPP 390 PPPP GG GPP PP G P P PPP Sbjct: 690 PPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPP 727 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPP 390 P PP P P G P P PPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 473 GXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 G P PP P PP P P PPP P P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P PP P PP P P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPP-----PFPPPPPPTP 496 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P PP P P PPP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 473 GXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 G G PP P PP P P PPP P P F Sbjct: 455 GDTEGVGQAPPPPPPP--PPPPPPPPPPPPPPPPPF 488 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXP------PFXGGXPXPXPPPXXPXXP 372 K PR GG G P GPP P P+ G P PP P P Sbjct: 60 KESSAPRRGGYGGGPPRGPPRGHPMRGRGAPYGRGGPPSRGPPRGPPLP 108 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXP 408 P R G G P GPP P PP G P Sbjct: 90 PYGRGGPPSRGPPRGPPLPGPPRRGPPP 117 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP G P PP P PF G P PPP P Sbjct: 181 PPPP-------GAPAAPPAP--PFGGPPSAPPPPPAPP 209 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 3/44 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP---PPXXPXXP 372 P PP P PP P PP P P PP P P Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 31.5 bits (68), Expect = 1.0 Identities = 27/84 (32%), Positives = 28/84 (33%), Gaps = 3/84 (3%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGG--GSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPX 450 G G PGL G G G+P P G G PP G P Sbjct: 58 GPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGV--NGPPGELGDMGPPGPP 115 Query: 449 GPPXPX-PPFXGGXPXPXPPPXXP 381 GPP P PP G P P P P Sbjct: 116 GPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 30.3 bits (65), Expect = 2.4 Identities = 27/82 (32%), Positives = 29/82 (35%), Gaps = 4/82 (4%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G+P P G G + P PP G G P GP Sbjct: 231 GPPGDVGPPGNPGG-PGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPP-GLP-GP 287 Query: 443 PXPX----PPFXGGXPXPXPPP 390 P P PP G P P PP Sbjct: 288 PGPQMPPGPPGLPGAPGPKGPP 309 Score = 29.9 bits (64), Expect = 3.1 Identities = 27/91 (29%), Positives = 29/91 (31%), Gaps = 10/91 (10%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGG--GSPXXXXXPXGGGGXFFXIKX--PPPPRXGGXXXGTPX- 450 G PG G G G P P GG + P P+ G P Sbjct: 295 GPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGI 354 Query: 449 -GPPXPX----PPFXGGXPXPXPPPXXPXXP 372 GPP P PP G P P PP P P Sbjct: 355 NGPPGPLGDVGPPGLPGPPGPQMPPGPPGLP 385 Score = 29.9 bits (64), Expect = 3.1 Identities = 27/91 (29%), Positives = 29/91 (31%), Gaps = 10/91 (10%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGG--GSPXXXXXPXGGGGXFFXIKX--PPPPRXGGXXXGTPX- 450 G PG G G G P P GG + P P+ G P Sbjct: 380 GPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGI 439 Query: 449 -GPPXPX----PPFXGGXPXPXPPPXXPXXP 372 GPP P PP G P P PP P P Sbjct: 440 NGPPGPLGDVGPPGLPGPPGPQMPPGPPGLP 470 Score = 29.9 bits (64), Expect = 3.1 Identities = 27/91 (29%), Positives = 29/91 (31%), Gaps = 10/91 (10%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGG--GSPXXXXXPXGGGGXFFXIKX--PPPPRXGGXXXGTPX- 450 G PG G G G P P GG + P P+ G P Sbjct: 465 GPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGI 524 Query: 449 -GPPXPX----PPFXGGXPXPXPPPXXPXXP 372 GPP P PP G P P PP P P Sbjct: 525 NGPPGPLGDVGPPGLPGPPGPQMPPGPPGLP 555 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXG--GXPXPXPPPXXPXXP 372 PPPP P GP P P F G G P PP P P Sbjct: 31 PPPPYEAPPPPPGPPGPDGP-PGFPGPQGPNGPKGPPGLPGPP 72 Score = 28.7 bits (61), Expect = 7.3 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -2 Query: 557 GSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXP-XPPFXGGXPXPXPPPXXP 381 G+P P G G I PP G P GPP P PP G P P P P P Sbjct: 677 GNPAGVQGPNGQPGPP-GINGPPGQIGEMGPPGLP-GPPGPASPPSPPGPPGP-PGPNGP 733 Query: 380 XXP 372 P Sbjct: 734 PGP 736 Score = 28.7 bits (61), Expect = 7.3 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -2 Query: 557 GSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXP-XPPFXGGXPXPXPPPXXP 381 G+P P G G I PP G P GPP P PP G P P P P P Sbjct: 762 GNPAGSQGPNGQPGPP-GINGPPGQVGEMGPPGLP-GPPGPASPPSPPGPPGP-PGPKGP 818 Query: 380 XXP 372 P Sbjct: 819 PGP 821 Score = 28.7 bits (61), Expect = 7.3 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -2 Query: 557 GSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXP-XPPFXGGXPXPXPPPXXP 381 G+P P G G I PP G P GPP P PP G P P P P P Sbjct: 847 GNPAGSQGPNGQPGPP-GINGPPGQVGEMGPPGLP-GPPGPASPPSPPGPPGP-PGPKGP 903 Query: 380 XXP 372 P Sbjct: 904 PGP 906 Score = 28.3 bits (60), Expect = 9.6 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G+P P G G I PP P G P P Sbjct: 316 GPPGDVGPPGNPGG-PGYQGNHGNPAGPQGPNGQPGPP-GINGPPGPLGDVGPPGLPGPP 373 Query: 443 P---XPXPPFXGGXPXPXPPP 390 P PP G P P PP Sbjct: 374 GPQMPPGPPGLPGAPGPKGPP 394 Score = 28.3 bits (60), Expect = 9.6 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G+P P G G I PP P G P P Sbjct: 401 GPPGDVGPPGNPGG-PGYQGNHGNPAGPQGPNGQPGPP-GINGPPGPLGDVGPPGLPGPP 458 Query: 443 P---XPXPPFXGGXPXPXPPP 390 P PP G P P PP Sbjct: 459 GPQMPPGPPGLPGAPGPNGPP 479 Score = 28.3 bits (60), Expect = 9.6 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G+P P G G I PP P G P P Sbjct: 486 GPPGEAGPPGNPGG-PGYQGNHGNPAGPQGPNGQPGPP-GINGPPGPLGDVGPPGLPGPP 543 Query: 443 P---XPXPPFXGGXPXPXPPP 390 P PP G P P PP Sbjct: 544 GPQMPPGPPGLPGAPGPNGPP 564 Score = 28.3 bits (60), Expect = 9.6 Identities = 27/85 (31%), Positives = 29/85 (34%), Gaps = 1/85 (1%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G+P P G G + PP G P GP Sbjct: 571 GPPGEAGPPGNPGG-PGYQGNHGNPAGPQGPNGQPGPP-GVNGPPGEIGEIGPAGLP-GP 627 Query: 443 PXP-XPPFXGGXPXPXPPPXXPXXP 372 P P PP G P P P P P P Sbjct: 628 PGPASPPSPPGPPGP-PGPKGPPGP 651 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 31.5 bits (68), Expect = 1.0 Identities = 24/75 (32%), Positives = 27/75 (36%), Gaps = 5/75 (6%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXG---GXPXPXPP--PXXPXXPXFXXXFFXXXP 339 ++ PP R G G P GPP P G G P P PP P P + P Sbjct: 368 VQRPPGMRPPGAGNG-PGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPP 426 Query: 338 PXXXFFXXXXGXPPP 294 P F PPP Sbjct: 427 PPPGFPQFQPPPPPP 441 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P PP PP P PPP P Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVP 344 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 K PPPP P PP P PP G P PP P P Sbjct: 465 KPPPPP--------APALPPLPLPPELPGSPGDSPPATSPKQP 499 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 491 PPPRXGGXXXGTPXG--PPXPXPPFXGGXPXPXP 396 PPP G G P G PP P PP G P P Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 P P G P G P P GG P P PPP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPP 232 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 30.7 bits (66), Expect = 1.8 Identities = 25/96 (26%), Positives = 28/96 (29%), Gaps = 2/96 (2%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG--PPXPXPPFXGGXPXPXPPP 390 GG P P GG + PPP+ G P G P PP G P Sbjct: 35 GGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQ 94 Query: 389 XXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGG 282 P + PP PPP G G Sbjct: 95 PYGAPPTSGYPGYQQHPPPPQPSAQSYNAPPPAGYG 130 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXP 372 GP P PP P P PPP P P Sbjct: 58 GPTVPIPPTLPPPPPPPPPPLPPPPP 83 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXP 372 GP P PP P P PPP P P Sbjct: 282 GPTVPIPPTLPPPPPPPPPPLPPPPP 307 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 30.7 bits (66), Expect = 1.8 Identities = 26/90 (28%), Positives = 28/90 (31%), Gaps = 8/90 (8%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGG-----GXFFXIKXPPPPRXGGXXX 462 G G P PG + GG +P GGG PPP Sbjct: 184 GQPGGYYPPPG---GYQQPPPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPPPG 240 Query: 461 GTPXGPPX---PXPPFXGGXPXPXPPPXXP 381 G P PP P P GG P PP P Sbjct: 241 GYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 517 PPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXP 624 PP P G PPP + P PG G P P Sbjct: 411 PPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMRP 446 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 30.3 bits (65), Expect = 2.4 Identities = 23/78 (29%), Positives = 25/78 (32%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG+ G G P P G G I PP P+ GP Sbjct: 3767 GQKGSIGAPGIPGKIGEKGVPG-RPSTIAGPPGPPGRSKNISGPPGPQGPPGQASQIPGP 3825 Query: 443 PXPXPPFXGGXPXPXPPP 390 P P G P P PP Sbjct: 3826 PGPQ-----GPPGPPGPP 3838 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP G P G P P P G P PP P + P Sbjct: 1665 PPPPAPGPPGPDGPMGLPGPQGP--DGPKGPPGPPGLPGPQGIPG--YPGAPAGPPGRDG 1720 Query: 314 XXGXPPPXGG 285 G P P GG Sbjct: 1721 PMGPPGPSGG 1730 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = -2 Query: 524 GGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 GGG + P + T PP P PP P P PPP P P Sbjct: 658 GGGQTISVNPSIPIQILPIPIQTMVPPPPPPPP--PPPPPPPPPPPQPSTP 706 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P PP P PP P P PP P Sbjct: 683 PPPP-----PPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PP P P P P PP P P PPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P PP P P PPP P P Sbjct: 1308 PESPPPPPPP-----PPPPPPPPLPPTP 1330 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 K P PP T P P P F P P PPP P P Sbjct: 281 KAPVPPMTPPPAVVTAPPPAPPLPNFTSPSP-PPPPPLPPAMP 322 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 603 GSXXXGXFXXGGXGGGXPXXRXXPXGGGGXFFXDKXPPPPP 481 GS G G GGG GG + PPPPP Sbjct: 472 GSGYGGGSSSRGGGGGRSSSGGNSRSGGSSYKSSNPPPPPP 512 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = -2 Query: 455 PXGPPXPXP-PFXGGXPXPXPPPXXP 381 P PP P P P P P PPP P Sbjct: 682 PLTPPPPLPTPIASSEPLPLPPPPPP 707 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PP P TP PP P P P P PP P Sbjct: 230 PPAPPNPSKAIATP-NPPMPETPLPPATPNPFIPPASP 266 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGT-PXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP T P PP P P G P P P P P Sbjct: 189 PTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIP 230 >SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1021 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTP--XGPPXPXP-PFXGGXPXPXPPPXXPXXP 372 ++ PPPP G G P P P P P G P P P P Sbjct: 764 VRSPPPPYPGSRTSGNPHMGSSPAPIPSPTSTGSPQTPLTPHTPRFP 810 >SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -2 Query: 587 GXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXP 408 G F G P P G G P PP G G P P P PP G P Sbjct: 74 GFFLKGLNGPPGPPGAPGPPGEPGQVGMAGPPGPPGHVGED-GAPGAPGAPGPPGSPGAP 132 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPR P PP PP P PPP P Sbjct: 1057 PPPRKPSPPPSEPAPPPRQPPP--PSTSQPVPPPRQP 1091 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP PP P F P P PPP Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXX-GTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP G G P P P G P PPP P Sbjct: 56 PPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPP 390 P PP P PP P P PPP Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPP 390 PP P PP P P PPP Sbjct: 83 PPPPPPPPASNVPAPPPPP 101 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 6/44 (13%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXG--PPXPXPPFX----GGXPXPXPPPXXP 381 PPPP P G PP PP GG P P PP P Sbjct: 241 PPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMP 284 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 472 PPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPG-XGXXPXXPP 627 PP G G PPP G G PPP P P G P PP Sbjct: 2124 PPPMGQYGAPARPAMGPPPMG-SSRYGPPPPMGPARHSPSGPSPLGAPPSVPP 2175 >SB_46326| Best HMM Match : Scramblase (HMM E-Value=0) Length = 554 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 PPP G P P PP GG P P P P P + Sbjct: 243 PPPVDVQSGYAGQP--PQQGYPPPQGGYPPPQQPGYNPQQPGY 283 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP + P P PP P P P P P Sbjct: 284 PPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPP 324 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPP 574 PPPP G PPP PP Sbjct: 587 PPPPAHHVNKPGVPPPPPP 605 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.310 0.156 0.527 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,863,422 Number of Sequences: 59808 Number of extensions: 326024 Number of successful extensions: 2104 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2776707833 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -