BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F11 (948 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 50 4e-06 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 50 4e-06 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 50 4e-06 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 50 4e-06 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 42 0.001 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 42 0.001 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 42 0.001 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 42 0.001 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 42 0.001 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 42 0.001 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 42 0.001 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 42 0.001 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 42 0.001 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 42 0.001 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 42 0.001 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 38 0.027 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 38 0.027 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 38 0.027 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 38 0.027 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 38 0.027 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 38 0.027 AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p pro... 37 0.035 AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA... 37 0.035 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 37 0.047 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 37 0.047 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 37 0.047 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 37 0.047 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 36 0.081 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 36 0.081 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 36 0.081 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 35 0.14 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 35 0.14 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 35 0.14 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 35 0.14 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 35 0.14 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 34 0.25 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 34 0.25 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 34 0.25 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 34 0.33 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 34 0.33 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 34 0.33 BT030401-1|ABO52820.1| 451|Drosophila melanogaster FI01001p pro... 33 0.43 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 33 0.43 AY071031-1|AAL48653.1| 451|Drosophila melanogaster RE11345p pro... 33 0.43 AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p pro... 33 0.43 AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FB... 33 0.43 AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA ... 33 0.43 AE014134-682|AAF51057.1| 451|Drosophila melanogaster CG2939-PA ... 33 0.43 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 33 0.43 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 33 0.43 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 33 0.43 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 32 1.0 BT016135-1|AAV37020.1| 1218|Drosophila melanogaster GH06496p pro... 32 1.0 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 32 1.0 AY121713-1|AAM52040.1| 959|Drosophila melanogaster SD04710p pro... 32 1.0 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 32 1.0 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 32 1.0 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 32 1.0 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 32 1.0 AE013599-3326|AAG22194.1| 1218|Drosophila melanogaster CG6562-PB... 32 1.0 AE013599-3325|AAF46796.1| 1218|Drosophila melanogaster CG6562-PA... 32 1.0 AY058486-1|AAL13715.1| 416|Drosophila melanogaster GM13876p pro... 32 1.3 AE014296-1806|AAF50165.3| 416|Drosophila melanogaster CG32056-P... 32 1.3 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 31 1.7 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 31 1.7 AF184225-1|AAD55736.1| 377|Drosophila melanogaster BcDNA.GH0604... 31 1.7 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 31 1.7 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 31 1.7 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 31 1.7 AE013599-4026|AAF47319.2| 377|Drosophila melanogaster CG2668-PA... 31 1.7 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 31 2.3 BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p pro... 31 2.3 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 31 2.3 AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p pro... 31 2.3 AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protei... 31 2.3 AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-assoc... 31 2.3 AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA... 31 2.3 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 31 2.3 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 31 2.3 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 31 2.3 BT016106-1|AAV36991.1| 840|Drosophila melanogaster LD20133p pro... 31 3.1 BT015290-1|AAT94519.1| 313|Drosophila melanogaster GH12715p pro... 31 3.1 BT003175-1|AAO24930.1| 313|Drosophila melanogaster RH66362p pro... 31 3.1 BT001413-1|AAN71168.1| 324|Drosophila melanogaster GH11283p pro... 31 3.1 AY060346-1|AAL25385.1| 316|Drosophila melanogaster GH26622p pro... 31 3.1 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 31 3.1 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 31 3.1 AE014297-1700|AAN13569.1| 112|Drosophila melanogaster CG9759-PB... 31 3.1 AE014297-1699|AAF54958.1| 112|Drosophila melanogaster CG9759-PA... 31 3.1 AE013599-1605|AAM68615.1| 316|Drosophila melanogaster CG3798-PF... 31 3.1 AE013599-1604|AAM68616.2| 324|Drosophila melanogaster CG3798-PE... 31 3.1 AE013599-1603|AAM68614.1| 324|Drosophila melanogaster CG3798-PD... 31 3.1 AE013599-1602|AAF58446.1| 324|Drosophila melanogaster CG3798-PC... 31 3.1 AE013599-1601|AAM68613.1| 313|Drosophila melanogaster CG3798-PB... 31 3.1 AE013599-1600|AAM68612.1| 313|Drosophila melanogaster CG3798-PA... 31 3.1 BT003608-1|AAO39611.1| 377|Drosophila melanogaster GH19274p pro... 30 4.0 BT003318-1|AAO25078.1| 517|Drosophila melanogaster AT26991p pro... 30 4.0 BT001317-1|AAN71072.1| 517|Drosophila melanogaster AT15066p pro... 30 4.0 AY058563-1|AAL13792.1| 652|Drosophila melanogaster LD25239p pro... 30 4.0 AE014297-4154|AAF56730.2| 445|Drosophila melanogaster CG31058-P... 30 4.0 AE014296-1757|AAF50200.2| 734|Drosophila melanogaster CG32050-P... 30 4.0 AE014296-1420|AAF50445.2| 652|Drosophila melanogaster CG7185-PA... 30 4.0 AE014296-204|AAN11465.1| 517|Drosophila melanogaster CG9130-PB,... 30 4.0 AE014296-203|AAN11464.1| 517|Drosophila melanogaster CG9130-PA,... 30 4.0 X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal p... 30 5.3 X59449-1|CAA42068.1| 883|Drosophila melanogaster dynamin protein. 30 5.3 X59448-1|CAA42067.1| 836|Drosophila melanogaster dynamin protein. 30 5.3 X59435-1|CAA42061.1| 836|Drosophila melanogaster dynamnin-like ... 30 5.3 BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p pro... 30 5.3 BT010049-1|AAQ22518.1| 877|Drosophila melanogaster LD21622p pro... 30 5.3 AY118390-1|AAM48419.1| 873|Drosophila melanogaster RE39020p pro... 30 5.3 AF210315-1|AAF19646.1| 1133|Drosophila melanogaster bonus protein. 30 5.3 AE014298-2280|ABI30984.1| 830|Drosophila melanogaster CG18102-P... 30 5.3 AE014298-2279|ABI30983.1| 830|Drosophila melanogaster CG18102-P... 30 5.3 AE014298-2278|AAS65369.1| 830|Drosophila melanogaster CG18102-P... 30 5.3 AE014298-2277|AAN09373.1| 830|Drosophila melanogaster CG18102-P... 30 5.3 AE014298-2276|AAN09372.1| 830|Drosophila melanogaster CG18102-P... 30 5.3 AE014298-2275|AAS65368.1| 830|Drosophila melanogaster CG18102-P... 30 5.3 AE014298-2274|AAS65367.1| 877|Drosophila melanogaster CG18102-P... 30 5.3 AE014298-2273|AAS65366.1| 877|Drosophila melanogaster CG18102-P... 30 5.3 AE014298-2272|AAF48536.2| 877|Drosophila melanogaster CG18102-P... 30 5.3 AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA ... 30 5.3 AE014297-2826|AAF55786.2| 1133|Drosophila melanogaster CG5206-PA... 30 5.3 AE013599-3085|AAF46639.3| 873|Drosophila melanogaster CG10052-P... 30 5.3 BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p pro... 29 7.1 AY075095-1|AAL79357.1| 815|Drosophila melanogaster pygopus prot... 29 7.1 AY058500-1|AAL13729.1| 815|Drosophila melanogaster LD18280p pro... 29 7.1 AF457206-1|AAL91369.1| 815|Drosophila melanogaster pygopus prot... 29 7.1 AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease... 29 7.1 AF017777-12|AAC28405.1| 145|Drosophila melanogaster la costa pr... 29 7.1 AE014298-3140|AAF50816.1| 145|Drosophila melanogaster CG12794-P... 29 7.1 AE014297-4758|AAF57161.1| 815|Drosophila melanogaster CG11518-P... 29 7.1 AE014297-116|AAF52115.2| 559|Drosophila melanogaster CG12586-PA... 29 7.1 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 29 7.1 AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA ... 29 7.1 X54251-1|CAA38152.1| 1596|Drosophila melanogaster nuclear protei... 29 9.3 BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p pro... 29 9.3 AY113619-1|AAM29624.1| 65|Drosophila melanogaster RH67809p pro... 29 9.3 AY113393-1|AAM29398.1| 891|Drosophila melanogaster RE07247p pro... 29 9.3 AE014298-1043|AAF46262.2| 65|Drosophila melanogaster CG11368-P... 29 9.3 AE014296-2707|AAF49484.2| 891|Drosophila melanogaster CG4998-PA... 29 9.3 AE014296-2706|ABI31256.1| 1185|Drosophila melanogaster CG4998-PB... 29 9.3 AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA... 29 9.3 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 50.4 bits (115), Expect = 4e-06 Identities = 30/80 (37%), Positives = 30/80 (37%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXF 354 P GGGG PPPP G G P PP P P GG P P PPP P Sbjct: 517 PPGGGGA---PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPP------ 567 Query: 353 FXXXPPXXXFFXXXXGXPPP 294 PP G PPP Sbjct: 568 ---PPPMPGMMRPGGGPPPP 584 Score = 45.6 bits (103), Expect = 1e-04 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 I PPPP GG G P PP P P GG P P PPP P Sbjct: 511 IPMPPPPPGGG---GAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 38.7 bits (86), Expect = 0.012 Identities = 31/89 (34%), Positives = 32/89 (35%), Gaps = 2/89 (2%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGG--GGXFFXIKXPPPPRXGGXXXG 459 P GG P P + G GGG P P G GG PPPP G G Sbjct: 518 PGGGGAPPPPPPPMPGR-----AGGGPPPPPPPPMPGRAGGP-----PPPPPPPG---MG 564 Query: 458 TPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P GG P P P P P Sbjct: 565 GPPPPPMPGMMRPGGGPPPPPMMMGPMVP 593 Score = 37.9 bits (84), Expect = 0.020 Identities = 27/81 (33%), Positives = 28/81 (34%) Frame = -3 Query: 532 PXGGGVFFLX*KXPPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPPLXXRXXXFFXXLF 353 P GGG PPPP G GP PP P P G P PP + Sbjct: 518 PGGGGAP----PPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP---------PGMG 564 Query: 352 XXGXPPXXFFFXXXGGXPPPP 290 PP GG PPPP Sbjct: 565 GPPPPPMPGMMRPGGGPPPPP 585 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPP 627 +P PP GGG PPPP G PPP P PG P PP Sbjct: 511 IPMPPPPPGGGGA----PPPPPPPMPGRAGGGPPPP-----PPPPMPGRAGGPPPPP 558 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP R G PPP PP P G P G Sbjct: 542 PPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGG 580 Score = 32.3 bits (70), Expect = 1.0 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +1 Query: 454 GVPXXXP---PXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXP 624 G P P P R GGG PPPP G PPP P PG G P P Sbjct: 522 GAPPPPPPPMPGRAGGG-----PPPPPPPPMPGRAGGPPP------PPPPPGMGGPPPPP 570 Query: 625 PXG 633 G Sbjct: 571 MPG 573 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP R G PPP PP + P P G Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMG 564 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 50.4 bits (115), Expect = 4e-06 Identities = 30/80 (37%), Positives = 30/80 (37%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXF 354 P GGGG PPPP G G P PP P P GG P P PPP P Sbjct: 517 PPGGGGA---PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPP------ 567 Query: 353 FXXXPPXXXFFXXXXGXPPP 294 PP G PPP Sbjct: 568 ---PPPMPGMMRPGGGPPPP 584 Score = 45.6 bits (103), Expect = 1e-04 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 I PPPP GG G P PP P P GG P P PPP P Sbjct: 511 IPMPPPPPGGG---GAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 38.7 bits (86), Expect = 0.012 Identities = 31/89 (34%), Positives = 32/89 (35%), Gaps = 2/89 (2%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGG--GGXFFXIKXPPPPRXGGXXXG 459 P GG P P + G GGG P P G GG PPPP G G Sbjct: 518 PGGGGAPPPPPPPMPGR-----AGGGPPPPPPPPMPGRAGGP-----PPPPPPPG---MG 564 Query: 458 TPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P GG P P P P P Sbjct: 565 GPPPPPMPGMMRPGGGPPPPPMMMGPMVP 593 Score = 37.9 bits (84), Expect = 0.020 Identities = 27/81 (33%), Positives = 28/81 (34%) Frame = -3 Query: 532 PXGGGVFFLX*KXPPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPPLXXRXXXFFXXLF 353 P GGG PPPP G GP PP P P G P PP + Sbjct: 518 PGGGGAP----PPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP---------PGMG 564 Query: 352 XXGXPPXXFFFXXXGGXPPPP 290 PP GG PPPP Sbjct: 565 GPPPPPMPGMMRPGGGPPPPP 585 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPP 627 +P PP GGG PPPP G PPP P PG P PP Sbjct: 511 IPMPPPPPGGGGA----PPPPPPPMPGRAGGGPPPP-----PPPPMPGRAGGPPPPP 558 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP R G PPP PP P G P G Sbjct: 542 PPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGG 580 Score = 32.3 bits (70), Expect = 1.0 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +1 Query: 454 GVPXXXP---PXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXP 624 G P P P R GGG PPPP G PPP P PG G P P Sbjct: 522 GAPPPPPPPMPGRAGGG-----PPPPPPPPMPGRAGGPPP------PPPPPGMGGPPPPP 570 Query: 625 PXG 633 G Sbjct: 571 MPG 573 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP R G PPP PP + P P G Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMG 564 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 50.4 bits (115), Expect = 4e-06 Identities = 30/80 (37%), Positives = 30/80 (37%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXF 354 P GGGG PPPP G G P PP P P GG P P PPP P Sbjct: 517 PPGGGGA---PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPP------ 567 Query: 353 FXXXPPXXXFFXXXXGXPPP 294 PP G PPP Sbjct: 568 ---PPPMPGMMRPGGGPPPP 584 Score = 45.6 bits (103), Expect = 1e-04 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 I PPPP GG G P PP P P GG P P PPP P Sbjct: 511 IPMPPPPPGGG---GAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 38.7 bits (86), Expect = 0.012 Identities = 31/89 (34%), Positives = 32/89 (35%), Gaps = 2/89 (2%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGG--GGXFFXIKXPPPPRXGGXXXG 459 P GG P P + G GGG P P G GG PPPP G G Sbjct: 518 PGGGGAPPPPPPPMPGR-----AGGGPPPPPPPPMPGRAGGP-----PPPPPPPG---MG 564 Query: 458 TPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P GG P P P P P Sbjct: 565 GPPPPPMPGMMRPGGGPPPPPMMMGPMVP 593 Score = 37.9 bits (84), Expect = 0.020 Identities = 27/81 (33%), Positives = 28/81 (34%) Frame = -3 Query: 532 PXGGGVFFLX*KXPPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPPLXXRXXXFFXXLF 353 P GGG PPPP G GP PP P P G P PP + Sbjct: 518 PGGGGAP----PPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP---------PGMG 564 Query: 352 XXGXPPXXFFFXXXGGXPPPP 290 PP GG PPPP Sbjct: 565 GPPPPPMPGMMRPGGGPPPPP 585 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPP 627 +P PP GGG PPPP G PPP P PG P PP Sbjct: 511 IPMPPPPPGGGGA----PPPPPPPMPGRAGGGPPPP-----PPPPMPGRAGGPPPPP 558 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP R G PPP PP P G P G Sbjct: 542 PPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGG 580 Score = 32.3 bits (70), Expect = 1.0 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +1 Query: 454 GVPXXXP---PXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXP 624 G P P P R GGG PPPP G PPP P PG G P P Sbjct: 522 GAPPPPPPPMPGRAGGG-----PPPPPPPPMPGRAGGPPP------PPPPPGMGGPPPPP 570 Query: 625 PXG 633 G Sbjct: 571 MPG 573 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP R G PPP PP + P P G Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMG 564 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 50.4 bits (115), Expect = 4e-06 Identities = 30/80 (37%), Positives = 30/80 (37%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXF 354 P GGGG PPPP G G P PP P P GG P P PPP P Sbjct: 517 PPGGGGA---PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPP------ 567 Query: 353 FXXXPPXXXFFXXXXGXPPP 294 PP G PPP Sbjct: 568 ---PPPMPGMMRPGGGPPPP 584 Score = 45.6 bits (103), Expect = 1e-04 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 I PPPP GG G P PP P P GG P P PPP P Sbjct: 511 IPMPPPPPGGG---GAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 38.7 bits (86), Expect = 0.012 Identities = 31/89 (34%), Positives = 32/89 (35%), Gaps = 2/89 (2%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGG--GGXFFXIKXPPPPRXGGXXXG 459 P GG P P + G GGG P P G GG PPPP G G Sbjct: 518 PGGGGAPPPPPPPMPGR-----AGGGPPPPPPPPMPGRAGGP-----PPPPPPPG---MG 564 Query: 458 TPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P GG P P P P P Sbjct: 565 GPPPPPMPGMMRPGGGPPPPPMMMGPMVP 593 Score = 37.9 bits (84), Expect = 0.020 Identities = 27/81 (33%), Positives = 28/81 (34%) Frame = -3 Query: 532 PXGGGVFFLX*KXPPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPPLXXRXXXFFXXLF 353 P GGG PPPP G GP PP P P G P PP + Sbjct: 518 PGGGGAP----PPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPP---------PGMG 564 Query: 352 XXGXPPXXFFFXXXGGXPPPP 290 PP GG PPPP Sbjct: 565 GPPPPPMPGMMRPGGGPPPPP 585 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPP 627 +P PP GGG PPPP G PPP P PG P PP Sbjct: 511 IPMPPPPPGGGGA----PPPPPPPMPGRAGGGPPPP-----PPPPMPGRAGGPPPPP 558 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP R G PPP PP P G P G Sbjct: 542 PPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGG 580 Score = 32.3 bits (70), Expect = 1.0 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +1 Query: 454 GVPXXXP---PXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXP 624 G P P P R GGG PPPP G PPP P PG G P P Sbjct: 522 GAPPPPPPPMPGRAGGG-----PPPPPPPPMPGRAGGPPP------PPPPPGMGGPPPPP 570 Query: 625 PXG 633 G Sbjct: 571 MPG 573 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP R G PPP PP + P P G Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMG 564 >AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p protein. Length = 877 Score = 42.3 bits (95), Expect = 0.001 Identities = 28/80 (35%), Positives = 30/80 (37%), Gaps = 2/80 (2%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G P PG G G P GGGG ++ PPPP G P G Sbjct: 130 GGKSGNGPGPGTGGG----PGPGPGPPPHYGGGGGGGGHMGMRGPPPPAP--HLRGMPPG 183 Query: 446 --PPXPXPPFXGGXPXPXPP 393 PP P GG P PP Sbjct: 184 GPPPTQQPGGAGGGGGPPPP 203 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 573 GGXGGGXPXXRXXPXGGGGXFFXDKXPPPPPXXGXXXGDPGWAPXXLSPFFXGXAXXXPP 394 GG G G GGGG PPPP PG P P G PP Sbjct: 143 GGPGPGPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPP 202 Query: 393 P 391 P Sbjct: 203 P 203 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = -2 Query: 560 GGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPX----GPPXPXPPFXGGXPXPXPP 393 GG P GGG PPP GG G GPP P P G P PP Sbjct: 130 GGKSGNGPGPGTGGGP--GPGPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPP 187 Query: 392 PXXP 381 P Sbjct: 188 TQQP 191 Score = 29.9 bits (64), Expect = 5.3 Identities = 23/84 (27%), Positives = 25/84 (29%) Frame = +3 Query: 396 GXXXGXTPXKRGXGXGGPXRGPXXLXPXAGGGGXFYXKKXTPPPXGXXXXXXGXPPXXXX 575 G G P G GP GP GGGG + PPP G PP Sbjct: 130 GGKSGNGPGPGTGGGPGPGPGPPPHYGGGGGGGGHMGMRGPPPP---APHLRGMPP--GG 184 Query: 576 XKXPXKXXXRGXAXXPPXXXGXXP 647 + G PP G P Sbjct: 185 PPPTQQPGGAGGGGGPPPPYGQYP 208 >AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA, isoform A protein. Length = 2061 Score = 42.3 bits (95), Expect = 0.001 Identities = 28/80 (35%), Positives = 30/80 (37%), Gaps = 2/80 (2%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G P PG G G P GGGG ++ PPPP G P G Sbjct: 1314 GGKSGNGPGPGTGGG----PGPGPGPPPHYGGGGGGGGHMGMRGPPPPAP--HLRGMPPG 1367 Query: 446 --PPXPXPPFXGGXPXPXPP 393 PP P GG P PP Sbjct: 1368 GPPPTQQPGGAGGGGGPPPP 1387 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 573 GGXGGGXPXXRXXPXGGGGXFFXDKXPPPPPXXGXXXGDPGWAPXXLSPFFXGXAXXXPP 394 GG G G GGGG PPPP PG P P G PP Sbjct: 1327 GGPGPGPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPP 1386 Query: 393 P 391 P Sbjct: 1387 P 1387 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = -2 Query: 560 GGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPX----GPPXPXPPFXGGXPXPXPP 393 GG P GGG PPP GG G GPP P P G P PP Sbjct: 1314 GGKSGNGPGPGTGGGP--GPGPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPP 1371 Query: 392 PXXP 381 P Sbjct: 1372 TQQP 1375 Score = 29.9 bits (64), Expect = 5.3 Identities = 23/84 (27%), Positives = 25/84 (29%) Frame = +3 Query: 396 GXXXGXTPXKRGXGXGGPXRGPXXLXPXAGGGGXFYXKKXTPPPXGXXXXXXGXPPXXXX 575 G G P G GP GP GGGG + PPP G PP Sbjct: 1314 GGKSGNGPGPGTGGGPGPGPGPPPHYGGGGGGGGHMGMRGPPPP---APHLRGMPP--GG 1368 Query: 576 XKXPXKXXXRGXAXXPPXXXGXXP 647 + G PP G P Sbjct: 1369 PPPTQQPGGAGGGGGPPPPYGQYP 1392 >AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB, isoform B protein. Length = 2103 Score = 42.3 bits (95), Expect = 0.001 Identities = 28/80 (35%), Positives = 30/80 (37%), Gaps = 2/80 (2%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G P PG G G P GGGG ++ PPPP G P G Sbjct: 1356 GGKSGNGPGPGTGGG----PGPGPGPPPHYGGGGGGGGHMGMRGPPPPAP--HLRGMPPG 1409 Query: 446 --PPXPXPPFXGGXPXPXPP 393 PP P GG P PP Sbjct: 1410 GPPPTQQPGGAGGGGGPPPP 1429 Score = 34.3 bits (75), Expect = 0.25 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 573 GGXGGGXPXXRXXPXGGGGXFFXDKXPPPPPXXGXXXGDPGWAPXXLSPFFXGXAXXXPP 394 GG G G GGGG PPPP PG P P G PP Sbjct: 1369 GGPGPGPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPP 1428 Query: 393 P 391 P Sbjct: 1429 P 1429 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = -2 Query: 560 GGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPX----GPPXPXPPFXGGXPXPXPP 393 GG P GGG PPP GG G GPP P P G P PP Sbjct: 1356 GGKSGNGPGPGTGGGP--GPGPGPPPHYGGGGGGGGHMGMRGPPPPAPHLRGMPPGGPPP 1413 Query: 392 PXXP 381 P Sbjct: 1414 TQQP 1417 Score = 29.9 bits (64), Expect = 5.3 Identities = 23/84 (27%), Positives = 25/84 (29%) Frame = +3 Query: 396 GXXXGXTPXKRGXGXGGPXRGPXXLXPXAGGGGXFYXKKXTPPPXGXXXXXXGXPPXXXX 575 G G P G GP GP GGGG + PPP G PP Sbjct: 1356 GGKSGNGPGPGTGGGPGPGPGPPPHYGGGGGGGGHMGMRGPPPP---APHLRGMPP--GG 1410 Query: 576 XKXPXKXXXRGXAXXPPXXXGXXP 647 + G PP G P Sbjct: 1411 PPPTQQPGGAGGGGGPPPPYGQYP 1434 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFX 348 G GG PPPP GG G P PP P F G P P P P Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPP-PPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 458 Query: 347 XXPPXXXFFXXXXGXPPPXGGG 282 PP PPP G G Sbjct: 459 GPPPAPGGPGAPPPPPPPPGLG 480 Score = 36.3 bits (80), Expect = 0.061 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG P G GGG P P GG PPP GG G P Sbjct: 422 GGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG-------PPPAPGGP--GAP-- 470 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P PP GG P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX------PXPPFXGGXPXPXPPPXXPXXP 372 PPPP GG P PP P P G P P PPP P Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAP 483 Score = 33.1 bits (72), Expect = 0.57 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 476 GGXXXGTPXGPPXPXPPF----XGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 GG PP P P F GG P P PP P PP Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPPAPPAPPAMG 457 Query: 308 GXPPPXGGGXXXXP 267 G PPP GG P Sbjct: 458 GGPPPAPGGPGAPP 471 Score = 32.7 bits (71), Expect = 0.76 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP--LFXGVXPXXXPPLXXRXXXFFXXLFXXGXPPXXFFF 320 PPPP+ G G GPP P P +F G P PP G PP Sbjct: 411 PPPPSFGGAAGG---GPPPPAPPQMFNGAPP---PPA-----------MGGGPPPAPPAP 453 Query: 319 XXXGGXPPP-PGGAXXXXPXFXP 254 GG PPP PGG P P Sbjct: 454 PAMGGGPPPAPGGPGAPPPPPPP 476 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPP G G PPP PP P G P Sbjct: 412 PPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPP 447 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 288 PGGGGXPPXXXKKXXXGGXPXKK 356 PGG G PP GG P K+ Sbjct: 464 PGGPGAPPPPPPPPGLGGAPKKE 486 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 189 GXGXPPLIXXXXXXGXXQTKXXGXKXGXXXXAPPGGGGXPP 311 G G PP G G APP GG PP Sbjct: 421 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 461 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFX 348 G GG PPPP GG G P PP P F G P P P P Sbjct: 403 GPGGPPAPAPPPPPPSFGGAAGGGPP-PPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 461 Query: 347 XXPPXXXFFXXXXGXPPPXGGG 282 PP PPP G G Sbjct: 462 GPPPAPGGPGAPPPPPPPPGLG 483 Score = 36.3 bits (80), Expect = 0.061 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG P G GGG P P GG PPP GG G P Sbjct: 425 GGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG-------PPPAPGGP--GAP-- 473 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P PP GG P P Sbjct: 474 PPPPPPPGLGGAPKKEDP 491 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX------PXPPFXGGXPXPXPPPXXPXXP 372 PPPP GG P PP P P G P P PPP P Sbjct: 440 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAP 486 Score = 33.1 bits (72), Expect = 0.57 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 476 GGXXXGTPXGPPXPXPPF----XGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 GG PP P P F GG P P PP P PP Sbjct: 402 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPPAPPAPPAMG 460 Query: 308 GXPPPXGGGXXXXP 267 G PPP GG P Sbjct: 461 GGPPPAPGGPGAPP 474 Score = 32.7 bits (71), Expect = 0.76 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP--LFXGVXPXXXPPLXXRXXXFFXXLFXXGXPPXXFFF 320 PPPP+ G G GPP P P +F G P PP G PP Sbjct: 414 PPPPSFGGAAGG---GPPPPAPPQMFNGAPP---PPA-----------MGGGPPPAPPAP 456 Query: 319 XXXGGXPPP-PGGAXXXXPXFXP 254 GG PPP PGG P P Sbjct: 457 PAMGGGPPPAPGGPGAPPPPPPP 479 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPP G G PPP PP P G P Sbjct: 415 PPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPP 450 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 288 PGGGGXPPXXXKKXXXGGXPXKK 356 PGG G PP GG P K+ Sbjct: 467 PGGPGAPPPPPPPPGLGGAPKKE 489 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 189 GXGXPPLIXXXXXXGXXQTKXXGXKXGXXXXAPPGGGGXPP 311 G G PP G G APP GG PP Sbjct: 424 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 464 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFX 348 G GG PPPP GG G P PP P F G P P P P Sbjct: 546 GPGGPPAPAPPPPPPSFGGAAGGGPP-PPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 604 Query: 347 XXPPXXXFFXXXXGXPPPXGGG 282 PP PPP G G Sbjct: 605 GPPPAPGGPGAPPPPPPPPGLG 626 Score = 36.3 bits (80), Expect = 0.061 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG P G GGG P P GG PPP GG G P Sbjct: 568 GGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG-------PPPAPGGP--GAP-- 616 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P PP GG P P Sbjct: 617 PPPPPPPGLGGAPKKEDP 634 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX------PXPPFXGGXPXPXPPPXXPXXP 372 PPPP GG P PP P P G P P PPP P Sbjct: 583 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAP 629 Score = 33.1 bits (72), Expect = 0.57 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 476 GGXXXGTPXGPPXPXPPF----XGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 GG PP P P F GG P P PP P PP Sbjct: 545 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPPAPPAPPAMG 603 Query: 308 GXPPPXGGGXXXXP 267 G PPP GG P Sbjct: 604 GGPPPAPGGPGAPP 617 Score = 32.7 bits (71), Expect = 0.76 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP--LFXGVXPXXXPPLXXRXXXFFXXLFXXGXPPXXFFF 320 PPPP+ G G GPP P P +F G P PP G PP Sbjct: 557 PPPPSFGGAAGG---GPPPPAPPQMFNGAPP---PPA-----------MGGGPPPAPPAP 599 Query: 319 XXXGGXPPP-PGGAXXXXPXFXP 254 GG PPP PGG P P Sbjct: 600 PAMGGGPPPAPGGPGAPPPPPPP 622 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPP G G PPP PP P G P Sbjct: 558 PPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPP 593 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 288 PGGGGXPPXXXKKXXXGGXPXKK 356 PGG G PP GG P K+ Sbjct: 610 PGGPGAPPPPPPPPGLGGAPKKE 632 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 189 GXGXPPLIXXXXXXGXXQTKXXGXKXGXXXXAPPGGGGXPP 311 G G PP G G APP GG PP Sbjct: 567 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 607 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFX 348 G GG PPPP GG G P PP P F G P P P P Sbjct: 545 GPGGPPAPAPPPPPPSFGGAAGGGPP-PPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 603 Query: 347 XXPPXXXFFXXXXGXPPPXGGG 282 PP PPP G G Sbjct: 604 GPPPAPGGPGAPPPPPPPPGLG 625 Score = 36.3 bits (80), Expect = 0.061 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG P G GGG P P GG PPP GG G P Sbjct: 567 GGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG-------PPPAPGGP--GAP-- 615 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P PP GG P P Sbjct: 616 PPPPPPPGLGGAPKKEDP 633 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX------PXPPFXGGXPXPXPPPXXPXXP 372 PPPP GG P PP P P G P P PPP P Sbjct: 582 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAP 628 Score = 33.1 bits (72), Expect = 0.57 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 476 GGXXXGTPXGPPXPXPPF----XGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 GG PP P P F GG P P PP P PP Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPPAPPAPPAMG 602 Query: 308 GXPPPXGGGXXXXP 267 G PPP GG P Sbjct: 603 GGPPPAPGGPGAPP 616 Score = 32.7 bits (71), Expect = 0.76 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP--LFXGVXPXXXPPLXXRXXXFFXXLFXXGXPPXXFFF 320 PPPP+ G G GPP P P +F G P PP G PP Sbjct: 556 PPPPSFGGAAGG---GPPPPAPPQMFNGAPP---PPA-----------MGGGPPPAPPAP 598 Query: 319 XXXGGXPPP-PGGAXXXXPXFXP 254 GG PPP PGG P P Sbjct: 599 PAMGGGPPPAPGGPGAPPPPPPP 621 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPP G G PPP PP P G P Sbjct: 557 PPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPP 592 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 288 PGGGGXPPXXXKKXXXGGXPXKK 356 PGG G PP GG P K+ Sbjct: 609 PGGPGAPPPPPPPPGLGGAPKKE 631 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 189 GXGXPPLIXXXXXXGXXQTKXXGXKXGXXXXAPPGGGGXPP 311 G G PP G G APP GG PP Sbjct: 566 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 606 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFX 348 G GG PPPP GG G P PP P F G P P P P Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPP-PPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 458 Query: 347 XXPPXXXFFXXXXGXPPPXGGG 282 PP PPP G G Sbjct: 459 GPPPAPGGPGAPPPPPPPPGLG 480 Score = 36.3 bits (80), Expect = 0.061 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG P G GGG P P GG PPP GG G P Sbjct: 422 GGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG-------PPPAPGGP--GAP-- 470 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P PP GG P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX------PXPPFXGGXPXPXPPPXXPXXP 372 PPPP GG P PP P P G P P PPP P Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAP 483 Score = 33.1 bits (72), Expect = 0.57 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 476 GGXXXGTPXGPPXPXPPF----XGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 GG PP P P F GG P P PP P PP Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPPAPPAPPAMG 457 Query: 308 GXPPPXGGGXXXXP 267 G PPP GG P Sbjct: 458 GGPPPAPGGPGAPP 471 Score = 32.7 bits (71), Expect = 0.76 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP--LFXGVXPXXXPPLXXRXXXFFXXLFXXGXPPXXFFF 320 PPPP+ G G GPP P P +F G P PP G PP Sbjct: 411 PPPPSFGGAAGG---GPPPPAPPQMFNGAPP---PPA-----------MGGGPPPAPPAP 453 Query: 319 XXXGGXPPP-PGGAXXXXPXFXP 254 GG PPP PGG P P Sbjct: 454 PAMGGGPPPAPGGPGAPPPPPPP 476 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPP G G PPP PP P G P Sbjct: 412 PPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPP 447 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 288 PGGGGXPPXXXKKXXXGGXPXKK 356 PGG G PP GG P K+ Sbjct: 464 PGGPGAPPPPPPPPGLGGAPKKE 486 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 189 GXGXPPLIXXXXXXGXXQTKXXGXKXGXXXXAPPGGGGXPP 311 G G PP G G APP GG PP Sbjct: 421 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 461 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFX 348 G GG PPPP GG G P PP P F G P P P P Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPP-PPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 458 Query: 347 XXPPXXXFFXXXXGXPPPXGGG 282 PP PPP G G Sbjct: 459 GPPPAPGGPGAPPPPPPPPGLG 480 Score = 36.3 bits (80), Expect = 0.061 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG P G GGG P P GG PPP GG G P Sbjct: 422 GGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG-------PPPAPGGP--GAP-- 470 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P PP GG P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX------PXPPFXGGXPXPXPPPXXPXXP 372 PPPP GG P PP P P G P P PPP P Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAP 483 Score = 33.1 bits (72), Expect = 0.57 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 476 GGXXXGTPXGPPXPXPPF----XGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 GG PP P P F GG P P PP P PP Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPPAPPAPPAMG 457 Query: 308 GXPPPXGGGXXXXP 267 G PPP GG P Sbjct: 458 GGPPPAPGGPGAPP 471 Score = 32.7 bits (71), Expect = 0.76 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP--LFXGVXPXXXPPLXXRXXXFFXXLFXXGXPPXXFFF 320 PPPP+ G G GPP P P +F G P PP G PP Sbjct: 411 PPPPSFGGAAGG---GPPPPAPPQMFNGAPP---PPA-----------MGGGPPPAPPAP 453 Query: 319 XXXGGXPPP-PGGAXXXXPXFXP 254 GG PPP PGG P P Sbjct: 454 PAMGGGPPPAPGGPGAPPPPPPP 476 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPP G G PPP PP P G P Sbjct: 412 PPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPP 447 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 288 PGGGGXPPXXXKKXXXGGXPXKK 356 PGG G PP GG P K+ Sbjct: 464 PGGPGAPPPPPPPPGLGGAPKKE 486 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 189 GXGXPPLIXXXXXXGXXQTKXXGXKXGXXXXAPPGGGGXPP 311 G G PP G G APP GG PP Sbjct: 421 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 461 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFX 348 G GG PPPP GG G P PP P F G P P P P Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPP-PPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 458 Query: 347 XXPPXXXFFXXXXGXPPPXGGG 282 PP PPP G G Sbjct: 459 GPPPAPGGPGAPPPPPPPPGLG 480 Score = 36.3 bits (80), Expect = 0.061 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG P G GGG P P GG PPP GG G P Sbjct: 422 GGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG-------PPPAPGGP--GAP-- 470 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P PP GG P P Sbjct: 471 PPPPPPPGLGGAPKKEDP 488 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX------PXPPFXGGXPXPXPPPXXPXXP 372 PPPP GG P PP P P G P P PPP P Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAP 483 Score = 33.1 bits (72), Expect = 0.57 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 476 GGXXXGTPXGPPXPXPPF----XGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 GG PP P P F GG P P PP P PP Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPPAPPAPPAMG 457 Query: 308 GXPPPXGGGXXXXP 267 G PPP GG P Sbjct: 458 GGPPPAPGGPGAPP 471 Score = 32.7 bits (71), Expect = 0.76 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP--LFXGVXPXXXPPLXXRXXXFFXXLFXXGXPPXXFFF 320 PPPP+ G G GPP P P +F G P PP G PP Sbjct: 411 PPPPSFGGAAGG---GPPPPAPPQMFNGAPP---PPA-----------MGGGPPPAPPAP 453 Query: 319 XXXGGXPPP-PGGAXXXXPXFXP 254 GG PPP PGG P P Sbjct: 454 PAMGGGPPPAPGGPGAPPPPPPP 476 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPP G G PPP PP P G P Sbjct: 412 PPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPP 447 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 288 PGGGGXPPXXXKKXXXGGXPXKK 356 PGG G PP GG P K+ Sbjct: 464 PGGPGAPPPPPPPPGLGGAPKKE 486 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 189 GXGXPPLIXXXXXXGXXQTKXXGXKXGXXXXAPPGGGGXPP 311 G G PP G G APP GG PP Sbjct: 421 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 461 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFX 348 G GG PPPP GG G P PP P F G P P P P Sbjct: 403 GPGGPPAPAPPPPPPSFGGAAGGGPP-PPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 461 Query: 347 XXPPXXXFFXXXXGXPPPXGGG 282 PP PPP G G Sbjct: 462 GPPPAPGGPGAPPPPPPPPGLG 483 Score = 36.3 bits (80), Expect = 0.061 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG P G GGG P P GG PPP GG G P Sbjct: 425 GGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG-------PPPAPGGP--GAP-- 473 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P PP GG P P Sbjct: 474 PPPPPPPGLGGAPKKEDP 491 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX------PXPPFXGGXPXPXPPPXXPXXP 372 PPPP GG P PP P P G P P PPP P Sbjct: 440 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAP 486 Score = 33.1 bits (72), Expect = 0.57 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 476 GGXXXGTPXGPPXPXPPF----XGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 GG PP P P F GG P P PP P PP Sbjct: 402 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPP-PPAMGGGPPPAPPAPPAMG 460 Query: 308 GXPPPXGGGXXXXP 267 G PPP GG P Sbjct: 461 GGPPPAPGGPGAPP 474 Score = 32.7 bits (71), Expect = 0.76 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP--LFXGVXPXXXPPLXXRXXXFFXXLFXXGXPPXXFFF 320 PPPP+ G G GPP P P +F G P PP G PP Sbjct: 414 PPPPSFGGAAGG---GPPPPAPPQMFNGAPP---PPA-----------MGGGPPPAPPAP 456 Query: 319 XXXGGXPPP-PGGAXXXXPXFXP 254 GG PPP PGG P P Sbjct: 457 PAMGGGPPPAPGGPGAPPPPPPP 479 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPP G G PPP PP P G P Sbjct: 415 PPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPP 450 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 288 PGGGGXPPXXXKKXXXGGXPXKK 356 PGG G PP GG P K+ Sbjct: 467 PGGPGAPPPPPPPPGLGGAPKKE 489 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 189 GXGXPPLIXXXXXXGXXQTKXXGXKXGXXXXAPPGGGGXPP 311 G G PP G G APP GG PP Sbjct: 424 GGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPP 464 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 37.5 bits (83), Expect = 0.027 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -2 Query: 605 PXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPP 426 P G G GG P P G GG K P P G P GPP P P Sbjct: 483 PEGGFGGNGGKGDGGGVGPGGPGGPKGPGGP----KGPNGPNGPPGPPGPP-GPPGPPGP 537 Query: 425 FXGGXPXPXPPPXXPXXP 372 P P PP P P Sbjct: 538 KGPTKPGPFGPPGPPGPP 555 Score = 35.9 bits (79), Expect = 0.081 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 3/85 (3%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G G+ G G P P G G P PP G P G Sbjct: 488 GGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFG 547 Query: 446 PP-XPXPPFXGGXPXPXP--PPXXP 381 PP P PP G P P PP P Sbjct: 548 PPGPPGPPGPPGPTRPGPYGPPGPP 572 Score = 33.1 bits (72), Expect = 0.57 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP-PXXPXXP 372 P PP G P GPP P P G P PP P P P Sbjct: 580 PGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPP 621 Score = 31.9 bits (69), Expect = 1.3 Identities = 26/88 (29%), Positives = 27/88 (30%), Gaps = 2/88 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXG--GXXXGTPX 450 G G PG G G P P G P P R G G T Sbjct: 547 GPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP----GPPGPTRPGPPGPPGPTRP 602 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 GPP P P G P PP P P + Sbjct: 603 GPPGPTRPGPPGPTRPGPPGPSPNDPRY 630 Score = 31.1 bits (67), Expect = 2.3 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFX--IKXPPPPRXGGXXXGTPX 450 G G PG G G P P G G P PP G P Sbjct: 524 GPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP 583 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXP 372 GPP P P G P P P P P Sbjct: 584 GPPGPTRPGPPGPPGPTRP--GPPGP 607 Score = 30.7 bits (66), Expect = 3.1 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G P G G P P R G P GP Sbjct: 515 GPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGP 574 Query: 443 PXPXPPFXGGXPXP-XPPPXXPXXP 372 P P G P P P P P P Sbjct: 575 TGPTRPGPPGPPGPTRPGPPGPPGP 599 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 37.5 bits (83), Expect = 0.027 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -2 Query: 605 PXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPP 426 P G G GG P P G GG K P P G P GPP P P Sbjct: 99 PEGGFGGNGGKGDGGGVGPGGPGGPKGPGGP----KGPNGPNGPPGPPGPP-GPPGPPGP 153 Query: 425 FXGGXPXPXPPPXXPXXP 372 P P PP P P Sbjct: 154 KGPTKPGPFGPPGPPGPP 171 Score = 35.9 bits (79), Expect = 0.081 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 3/85 (3%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G G+ G G P P G G P PP G P G Sbjct: 104 GGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFG 163 Query: 446 PP-XPXPPFXGGXPXPXP--PPXXP 381 PP P PP G P P PP P Sbjct: 164 PPGPPGPPGPPGPTRPGPYGPPGPP 188 Score = 33.1 bits (72), Expect = 0.57 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP-PXXPXXP 372 P PP G P GPP P P G P PP P P P Sbjct: 196 PGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPP 237 Score = 31.9 bits (69), Expect = 1.3 Identities = 26/88 (29%), Positives = 27/88 (30%), Gaps = 2/88 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXG--GXXXGTPX 450 G G PG G G P P G P P R G G T Sbjct: 163 GPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP----GPPGPTRPGPPGPPGPTRP 218 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 GPP P P G P PP P P + Sbjct: 219 GPPGPTRPGPPGPTRPGPPGPSPNDPRY 246 Score = 31.1 bits (67), Expect = 2.3 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFX--IKXPPPPRXGGXXXGTPX 450 G G PG G G P P G G P PP G P Sbjct: 140 GPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP 199 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXP 372 GPP P P G P P P P P Sbjct: 200 GPPGPTRPGPPGPPGPTRP--GPPGP 223 Score = 30.7 bits (66), Expect = 3.1 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G P G G P P R G P GP Sbjct: 131 GPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGP 190 Query: 443 PXPXPPFXGGXPXP-XPPPXXPXXP 372 P P G P P P P P P Sbjct: 191 TGPTRPGPPGPPGPTRPGPPGPPGP 215 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 37.5 bits (83), Expect = 0.027 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -2 Query: 605 PXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPP 426 P G G GG P P G GG K P P G P GPP P P Sbjct: 513 PEGGFGGNGGKGDGGGVGPGGPGGPKGPGGP----KGPNGPNGPPGPPGPP-GPPGPPGP 567 Query: 425 FXGGXPXPXPPPXXPXXP 372 P P PP P P Sbjct: 568 KGPTKPGPFGPPGPPGPP 585 Score = 35.9 bits (79), Expect = 0.081 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 3/85 (3%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G G+ G G P P G G P PP G P G Sbjct: 518 GGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFG 577 Query: 446 PP-XPXPPFXGGXPXPXP--PPXXP 381 PP P PP G P P PP P Sbjct: 578 PPGPPGPPGPPGPTRPGPYGPPGPP 602 Score = 33.1 bits (72), Expect = 0.57 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP-PXXPXXP 372 P PP G P GPP P P G P PP P P P Sbjct: 610 PGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPP 651 Score = 31.9 bits (69), Expect = 1.3 Identities = 26/88 (29%), Positives = 27/88 (30%), Gaps = 2/88 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXG--GXXXGTPX 450 G G PG G G P P G P P R G G T Sbjct: 577 GPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP----GPPGPTRPGPPGPPGPTRP 632 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 GPP P P G P PP P P + Sbjct: 633 GPPGPTRPGPPGPTRPGPPGPSPNDPRY 660 Score = 31.1 bits (67), Expect = 2.3 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFX--IKXPPPPRXGGXXXGTPX 450 G G PG G G P P G G P PP G P Sbjct: 554 GPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP 613 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXP 372 GPP P P G P P P P P Sbjct: 614 GPPGPTRPGPPGPPGPTRP--GPPGP 637 Score = 30.7 bits (66), Expect = 3.1 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G P G G P P R G P GP Sbjct: 545 GPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGP 604 Query: 443 PXPXPPFXGGXPXP-XPPPXXPXXP 372 P P G P P P P P P Sbjct: 605 TGPTRPGPPGPPGPTRPGPPGPPGP 629 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 37.5 bits (83), Expect = 0.027 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -2 Query: 605 PXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPP 426 P G G GG P P G GG K P P G P GPP P P Sbjct: 513 PEGGFGGNGGKGDGGGVGPGGPGGPKGPGGP----KGPNGPNGPPGPPGPP-GPPGPPGP 567 Query: 425 FXGGXPXPXPPPXXPXXP 372 P P PP P P Sbjct: 568 KGPTKPGPFGPPGPPGPP 585 Score = 35.9 bits (79), Expect = 0.081 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 3/85 (3%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G G+ G G P P G G P PP G P G Sbjct: 518 GGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFG 577 Query: 446 PP-XPXPPFXGGXPXPXP--PPXXP 381 PP P PP G P P PP P Sbjct: 578 PPGPPGPPGPPGPTRPGPYGPPGPP 602 Score = 33.1 bits (72), Expect = 0.57 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP-PXXPXXP 372 P PP G P GPP P P G P PP P P P Sbjct: 610 PGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPP 651 Score = 31.9 bits (69), Expect = 1.3 Identities = 26/88 (29%), Positives = 27/88 (30%), Gaps = 2/88 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXG--GXXXGTPX 450 G G PG G G P P G P P R G G T Sbjct: 577 GPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP----GPPGPTRPGPPGPPGPTRP 632 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 GPP P P G P PP P P + Sbjct: 633 GPPGPTRPGPPGPTRPGPPGPSPNDPRY 660 Score = 31.1 bits (67), Expect = 2.3 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFX--IKXPPPPRXGGXXXGTPX 450 G G PG G G P P G G P PP G P Sbjct: 554 GPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP 613 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXP 372 GPP P P G P P P P P Sbjct: 614 GPPGPTRPGPPGPPGPTRP--GPPGP 637 Score = 30.7 bits (66), Expect = 3.1 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G P G G P P R G P GP Sbjct: 545 GPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGP 604 Query: 443 PXPXPPFXGGXPXP-XPPPXXPXXP 372 P P G P P P P P P Sbjct: 605 TGPTRPGPPGPPGPTRPGPPGPPGP 629 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 37.5 bits (83), Expect = 0.027 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -2 Query: 605 PXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPP 426 P G G GG P P G GG K P P G P GPP P P Sbjct: 99 PEGGFGGNGGKGDGGGVGPGGPGGPKGPGGP----KGPNGPNGPPGPPGPP-GPPGPPGP 153 Query: 425 FXGGXPXPXPPPXXPXXP 372 P P PP P P Sbjct: 154 KGPTKPGPFGPPGPPGPP 171 Score = 35.9 bits (79), Expect = 0.081 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 3/85 (3%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G G+ G G P P G G P PP G P G Sbjct: 104 GGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFG 163 Query: 446 PP-XPXPPFXGGXPXPXP--PPXXP 381 PP P PP G P P PP P Sbjct: 164 PPGPPGPPGPPGPTRPGPYGPPGPP 188 Score = 33.1 bits (72), Expect = 0.57 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP-PXXPXXP 372 P PP G P GPP P P G P PP P P P Sbjct: 196 PGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPP 237 Score = 31.9 bits (69), Expect = 1.3 Identities = 26/88 (29%), Positives = 27/88 (30%), Gaps = 2/88 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXG--GXXXGTPX 450 G G PG G G P P G P P R G G T Sbjct: 163 GPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP----GPPGPTRPGPPGPPGPTRP 218 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 GPP P P G P PP P P + Sbjct: 219 GPPGPTRPGPPGPTRPGPPGPSPNDPRY 246 Score = 31.1 bits (67), Expect = 2.3 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFX--IKXPPPPRXGGXXXGTPX 450 G G PG G G P P G G P PP G P Sbjct: 140 GPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP 199 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXP 372 GPP P P G P P P P P Sbjct: 200 GPPGPTRPGPPGPPGPTRP--GPPGP 223 Score = 30.7 bits (66), Expect = 3.1 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G P G G P P R G P GP Sbjct: 131 GPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGP 190 Query: 443 PXPXPPFXGGXPXP-XPPPXXPXXP 372 P P G P P P P P P Sbjct: 191 TGPTRPGPPGPPGPTRPGPPGPPGP 215 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 37.5 bits (83), Expect = 0.027 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -2 Query: 605 PXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPP 426 P G G GG P P G GG K P P G P GPP P P Sbjct: 99 PEGGFGGNGGKGDGGGVGPGGPGGPKGPGGP----KGPNGPNGPPGPPGPP-GPPGPPGP 153 Query: 425 FXGGXPXPXPPPXXPXXP 372 P P PP P P Sbjct: 154 KGPTKPGPFGPPGPPGPP 171 Score = 35.9 bits (79), Expect = 0.081 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 3/85 (3%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G G+ G G P P G G P PP G P G Sbjct: 104 GGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFG 163 Query: 446 PP-XPXPPFXGGXPXPXP--PPXXP 381 PP P PP G P P PP P Sbjct: 164 PPGPPGPPGPPGPTRPGPYGPPGPP 188 Score = 33.1 bits (72), Expect = 0.57 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP-PXXPXXP 372 P PP G P GPP P P G P PP P P P Sbjct: 196 PGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPGPTRPGPP 237 Score = 31.9 bits (69), Expect = 1.3 Identities = 26/88 (29%), Positives = 27/88 (30%), Gaps = 2/88 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXG--GXXXGTPX 450 G G PG G G P P G P P R G G T Sbjct: 163 GPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP----GPPGPTRPGPPGPPGPTRP 218 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 GPP P P G P PP P P + Sbjct: 219 GPPGPTRPGPPGPTRPGPPGPSPNDPRY 246 Score = 31.1 bits (67), Expect = 2.3 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFX--IKXPPPPRXGGXXXGTPX 450 G G PG G G P P G G P PP G P Sbjct: 140 GPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP 199 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXP 372 GPP P P G P P P P P Sbjct: 200 GPPGPTRPGPPGPPGPTRP--GPPGP 223 Score = 30.7 bits (66), Expect = 3.1 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG G G P G G P P R G P GP Sbjct: 131 GPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGP 190 Query: 443 PXPXPPFXGGXPXP-XPPPXXPXXP 372 P P G P P P P P P Sbjct: 191 TGPTRPGPPGPPGPTRPGPPGPPGP 215 >AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p protein. Length = 362 Score = 37.1 bits (82), Expect = 0.035 Identities = 28/78 (35%), Positives = 29/78 (37%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G P PG G GG P GGG PPPP G G Sbjct: 160 GGGRGPPPRPGFNG--------GGPPPPRPGWNGGG--------PPPPMPGWNGGG---- 199 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P P + GG P P P Sbjct: 200 PPPPRPGWNGGGPPPPRP 217 Score = 35.9 bits (79), Expect = 0.081 Identities = 27/78 (34%), Positives = 28/78 (35%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 G G PG G GGG P GG PPPPR G G Sbjct: 141 GWNGGGGQGPGWNGP---GWNGGGGRGPPPRPGFNGGG------PPPPRPGWNGGG---- 187 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P P + GG P P P Sbjct: 188 PPPPMPGWNGGGPPPPRP 205 Score = 29.5 bits (63), Expect = 7.1 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -1 Query: 339 PPXXFFFXXXGXXPPXRGGXXXXXPXXXPXFLFGXXPXXRXXX*GGGPXNP 187 PP F G PP G P P + G P R GGGP P Sbjct: 165 PPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPP 215 >AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA protein. Length = 362 Score = 37.1 bits (82), Expect = 0.035 Identities = 28/78 (35%), Positives = 29/78 (37%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G P PG G GG P GGG PPPP G G Sbjct: 160 GGGRGPPPRPGFNG--------GGPPPPRPGWNGGG--------PPPPMPGWNGGG---- 199 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P P + GG P P P Sbjct: 200 PPPPRPGWNGGGPPPPRP 217 Score = 35.9 bits (79), Expect = 0.081 Identities = 27/78 (34%), Positives = 28/78 (35%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 G G PG G GGG P GG PPPPR G G Sbjct: 141 GWNGGGGQGPGWNGP---GWNGGGGRGPPPRPGFNGGG------PPPPRPGWNGGG---- 187 Query: 446 PPXPXPPFXGGXPXPXPP 393 PP P P + GG P P P Sbjct: 188 PPPPMPGWNGGGPPPPRP 205 Score = 29.5 bits (63), Expect = 7.1 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -1 Query: 339 PPXXFFFXXXGXXPPXRGGXXXXXPXXXPXFLFGXXPXXRXXX*GGGPXNP 187 PP F G PP G P P + G P R GGGP P Sbjct: 165 PPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPP 215 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 36.7 bits (81), Expect = 0.047 Identities = 24/90 (26%), Positives = 27/90 (30%) Frame = -2 Query: 551 PXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P P G + + P PP P P P PP P P PP P Sbjct: 314 PRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPGP 373 Query: 371 XFXXXFFXXXPPXXXFFXXXXGXPPPXGGG 282 + PP G PPP GG Sbjct: 374 T-----YQPRPPAPPAPTPEYGPPPPTSGG 398 Score = 33.1 bits (72), Expect = 0.57 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP G P PP P P P PP P P Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRP 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/78 (28%), Positives = 23/78 (29%) Frame = -2 Query: 605 PXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPP 426 P PG G G P G PPPP+ GPP PP Sbjct: 42 PPPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPP 101 Query: 425 FXGGXPXPXPPPXXPXXP 372 P P P P P P Sbjct: 102 ----RPPPQPTPSAPAPP 115 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXX-GTPXGPPXPXPPFXGGXPXPXPPP 390 PPPPR G P PP P P G P PPP Sbjct: 211 PPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPP 246 Score = 31.5 bits (68), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXG---GXPXPXPPPXXPXXP 372 PPP G P PP P P G P P PP P P Sbjct: 140 PPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSP 182 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -2 Query: 494 PPPPRXGGXXXGTPX-GPPXPXPPFXGGXPXPXPP---PXXPXXP 372 PPPP TP GPP P P P P PP P P P Sbjct: 224 PPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPP 268 Score = 30.3 bits (65), Expect = 4.0 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = -2 Query: 554 SPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 +P P G + P PR P PP P G P P PPP P Sbjct: 176 APQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 30.3 bits (65), Expect = 4.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP G PP PP P+ PG G P G Sbjct: 210 PPPPPRPQPTPGYGPPPPPPPPKPQPT-PGYGPPTPPPG 247 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 P PP P P G P P PPP P + Sbjct: 210 PPPPPRPQPTPGYGPPPPPPPPKPQPTPGY 239 Score = 29.1 bits (62), Expect = 9.3 Identities = 22/72 (30%), Positives = 24/72 (33%), Gaps = 1/72 (1%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PP P+ G P P P P P P PPP P + PP Sbjct: 182 PPSPQPGPEYL--PPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPP--PPPPPPKPQPTP 237 Query: 314 XXGXP-PPXGGG 282 G P PP G G Sbjct: 238 GYGPPTPPPGPG 249 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPP 392 PPPP + P GPP P P P PP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPP 258 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 271 PPPP----PPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G PP P PP G P PPP Sbjct: 285 PPPPPINGA------APPPPPPPMINGGALPPPPP 313 Score = 29.5 bits (63), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P PP P P PPP P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAP 295 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 36.7 bits (81), Expect = 0.047 Identities = 24/90 (26%), Positives = 27/90 (30%) Frame = -2 Query: 551 PXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P P G + + P PP P P P PP P P PP P Sbjct: 314 PRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPGP 373 Query: 371 XFXXXFFXXXPPXXXFFXXXXGXPPPXGGG 282 + PP G PPP GG Sbjct: 374 T-----YQPRPPAPPAPTPEYGPPPPTSGG 398 Score = 33.1 bits (72), Expect = 0.57 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP G P PP P P P PP P P Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRP 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/78 (28%), Positives = 23/78 (29%) Frame = -2 Query: 605 PXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPP 426 P PG G G P G PPPP+ GPP PP Sbjct: 42 PPPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPP 101 Query: 425 FXGGXPXPXPPPXXPXXP 372 P P P P P P Sbjct: 102 ----RPPPQPTPSAPAPP 115 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXX-GTPXGPPXPXPPFXGGXPXPXPPP 390 PPPPR G P PP P P G P PPP Sbjct: 211 PPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPP 246 Score = 31.5 bits (68), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXG---GXPXPXPPPXXPXXP 372 PPP G P PP P P G P P PP P P Sbjct: 140 PPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSP 182 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -2 Query: 494 PPPPRXGGXXXGTPX-GPPXPXPPFXGGXPXPXPP---PXXPXXP 372 PPPP TP GPP P P P P PP P P P Sbjct: 224 PPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPP 268 Score = 30.3 bits (65), Expect = 4.0 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = -2 Query: 554 SPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 +P P G + P PR P PP P G P P PPP P Sbjct: 176 APQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 30.3 bits (65), Expect = 4.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXPXXG 634 PPPP G PP PP P+ PG G P G Sbjct: 210 PPPPPRPQPTPGYGPPPPPPPPKPQPT-PGYGPPTPPPG 247 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 P PP P P G P P PPP P + Sbjct: 210 PPPPPRPQPTPGYGPPPPPPPPKPQPTPGY 239 Score = 29.1 bits (62), Expect = 9.3 Identities = 22/72 (30%), Positives = 24/72 (33%), Gaps = 1/72 (1%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PP P+ G P P P P P P PPP P + PP Sbjct: 182 PPSPQPGPEYL--PPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPP--PPPPPPKPQPTP 237 Query: 314 XXGXP-PPXGGG 282 G P PP G G Sbjct: 238 GYGPPTPPPGPG 249 Score = 29.1 bits (62), Expect = 9.3 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPP 392 PPPP + P GPP P P P PP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPP 258 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 271 PPPP----PPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G PP P PP G P PPP Sbjct: 285 PPPPPINGA------APPPPPPPMINGGALPPPPP 313 Score = 29.5 bits (63), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P PP P P PPP P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAP 295 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 35.9 bits (79), Expect = 0.081 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXG-GXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 490 PPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPP 525 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXX 276 P PP P P F P P PPP P + PP P P GG Sbjct: 487 PPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 546 Query: 275 XXP 267 P Sbjct: 547 IPP 549 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P PP P PPP P PP Sbjct: 489 PPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSG-----SAPPPPPPAPIEG 543 Query: 314 XXGXPPP 294 G PPP Sbjct: 544 GGGIPPP 550 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G+ PP P P GG P PPP Sbjct: 519 PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 553 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P P GG P PPP P Sbjct: 520 PPPPPPPPGSGSAP--PPPPPAPIEGGGGIPPPPPPMSASP 558 Score = 31.9 bits (69), Expect = 1.3 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXXP 267 PP P PP P PPP P P PP + PPP G G P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPP----------PPLANYGAPPPPPPPPPGSGSAPPP 535 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 35.9 bits (79), Expect = 0.081 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXG-GXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 585 PPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPP 620 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXX 276 P PP P P F P P PPP P + PP P P GG Sbjct: 582 PPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 641 Query: 275 XXP 267 P Sbjct: 642 IPP 644 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P PP P PPP P PP Sbjct: 584 PPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSG-----SAPPPPPPAPIEG 638 Query: 314 XXGXPPP 294 G PPP Sbjct: 639 GGGIPPP 645 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G+ PP P P GG P PPP Sbjct: 614 PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 648 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P P GG P PPP P Sbjct: 615 PPPPPPPPGSGSAP--PPPPPAPIEGGGGIPPPPPPMSASP 653 Score = 31.9 bits (69), Expect = 1.3 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXXP 267 PP P PP P PPP P P PP + PPP G G P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPP----------PPMANYGAPPPPPPPPPGSGSAPPP 630 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 35.9 bits (79), Expect = 0.081 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXG-GXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 718 PPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPP 753 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXX 276 P PP P P F P P PPP P + PP P P GG Sbjct: 715 PPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 774 Query: 275 XXP 267 P Sbjct: 775 IPP 777 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P PP P PPP P PP Sbjct: 717 PPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSG-----SAPPPPPPAPIEG 771 Query: 314 XXGXPPP 294 G PPP Sbjct: 772 GGGIPPP 778 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G+ PP P P GG P PPP Sbjct: 747 PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 781 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P P GG P PPP P Sbjct: 748 PPPPPPPPGSGSAP--PPPPPAPIEGGGGIPPPPPPMSASP 786 Score = 31.9 bits (69), Expect = 1.3 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXXP 267 PP P PP P PPP P P PP + PPP G G P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPP----------PPMANYGAPPPPPPPPPGSGSAPPP 763 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 35.1 bits (77), Expect = 0.14 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P PP P PPP P PP Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSG-----SAPPPPPPAPIEG 534 Query: 314 XXGXPPP 294 G PPP Sbjct: 535 GGGIPPP 541 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G+ PP P P GG P PPP Sbjct: 510 PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 544 Score = 33.5 bits (73), Expect = 0.43 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXXP 267 PP P PP P PPP P P PP + PPP G G P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPP----------PPLANYGAPPPPPPPPPGSGSAPPP 526 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P P GG P PPP P Sbjct: 511 PPPPPPPPGSGSAP--PPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 32.7 bits (71), Expect = 0.76 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPP---FXGGXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 479 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 516 Score = 32.3 bits (70), Expect = 1.0 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPP----XG 288 P PP P P P P PPP P P PP PPP G Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 534 Query: 287 GGXXXXP 267 GG P Sbjct: 535 GGGIPPP 541 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 35.1 bits (77), Expect = 0.14 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P PP P PPP P PP Sbjct: 490 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSG-----SAPPPPPPAPIEG 544 Query: 314 XXGXPPP 294 G PPP Sbjct: 545 GGGIPPP 551 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G+ PP P P GG P PPP Sbjct: 520 PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 554 Score = 33.5 bits (73), Expect = 0.43 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXXP 267 PP P PP P PPP P P PP + PPP G G P Sbjct: 487 PPPPPPPLHAFVAPPPPPPPPPPPP----------PPLANYGAPPPPPPPPPGSGSAPPP 536 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P P GG P PPP P Sbjct: 521 PPPPPPPPGSGSAP--PPPPPAPIEGGGGIPPPPPPMSASP 559 Score = 32.7 bits (71), Expect = 0.76 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPP---FXGGXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 489 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 526 Score = 32.3 bits (70), Expect = 1.0 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPP----XG 288 P PP P P P P PPP P P PP PPP G Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 544 Query: 287 GGXXXXP 267 GG P Sbjct: 545 GGGIPPP 551 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 35.1 bits (77), Expect = 0.14 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P PP P PPP P PP Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSG-----SAPPPPPPAPIEG 534 Query: 314 XXGXPPP 294 G PPP Sbjct: 535 GGGIPPP 541 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G+ PP P P GG P PPP Sbjct: 510 PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 544 Score = 33.5 bits (73), Expect = 0.43 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXXP 267 PP P PP P PPP P P PP + PPP G G P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPP----------PPLANYGAPPPPPPPPPGSGSAPPP 526 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P P GG P PPP P Sbjct: 511 PPPPPPPPGSGSAP--PPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 32.7 bits (71), Expect = 0.76 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPP---FXGGXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 479 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 516 Score = 32.3 bits (70), Expect = 1.0 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPP----XG 288 P PP P P P P PPP P P PP PPP G Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 534 Query: 287 GGXXXXP 267 GG P Sbjct: 535 GGGIPPP 541 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 35.1 bits (77), Expect = 0.14 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P PP P PPP P PP Sbjct: 638 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSG-----SAPPPPPPAPIEG 692 Query: 314 XXGXPPP 294 G PPP Sbjct: 693 GGGIPPP 699 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G+ PP P P GG P PPP Sbjct: 668 PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 702 Score = 33.5 bits (73), Expect = 0.43 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXXP 267 PP P PP P PPP P P PP + PPP G G P Sbjct: 635 PPPPPPPLHAFVAPPPPPPPPPPPP----------PPLANYGAPPPPPPPPPGSGSAPPP 684 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P P GG P PPP P Sbjct: 669 PPPPPPPPGSGSAP--PPPPPAPIEGGGGIPPPPPPMSASP 707 Score = 32.7 bits (71), Expect = 0.76 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPP---FXGGXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 637 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 674 Score = 32.3 bits (70), Expect = 1.0 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPP----XG 288 P PP P P P P PPP P P PP PPP G Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 692 Query: 287 GGXXXXP 267 GG P Sbjct: 693 GGGIPPP 699 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 35.1 bits (77), Expect = 0.14 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P PP P PPP P PP Sbjct: 585 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSG-----SAPPPPPPAPIEG 639 Query: 314 XXGXPPP 294 G PPP Sbjct: 640 GGGIPPP 646 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP G+ PP P P GG P PPP Sbjct: 615 PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 649 Score = 33.5 bits (73), Expect = 0.43 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXXP 267 PP P PP P PPP P P PP + PPP G G P Sbjct: 582 PPPPPPPLHAFVAPPPPPPPPPPPP----------PPLANYGAPPPPPPPPPGSGSAPPP 631 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P P GG P PPP P Sbjct: 616 PPPPPPPPGSGSAP--PPPPPAPIEGGGGIPPPPPPMSASP 654 Score = 32.7 bits (71), Expect = 0.76 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPP---FXGGXPXPXPPP 390 PPPP P PP P PP G P P PPP Sbjct: 584 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 621 Score = 32.3 bits (70), Expect = 1.0 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPP----XG 288 P PP P P P P PPP P P PP PPP G Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 639 Query: 287 GGXXXXP 267 GG P Sbjct: 640 GGGIPPP 646 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 I+ PPPP P PP PP P PPP P P Sbjct: 137 IEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 180 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 P PR T PP P PP P P PP P P PP Sbjct: 124 PASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTV 183 Query: 314 XXGXPPP 294 PPP Sbjct: 184 EPPPPPP 190 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 IK PPPP P PP P PP P P P P P Sbjct: 159 IKPPPPP---APPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPP 199 Score = 31.5 bits (68), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPP--XPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P PPP P P Sbjct: 151 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 193 Score = 30.3 bits (65), Expect = 4.0 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXF 324 + PPPPR PP P PP P P PP P PP Sbjct: 92 VNPPPPPRPASPKVE----PPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPT 147 Query: 323 FXXXXGXPPP 294 PP Sbjct: 148 LVPPPPPAPP 157 Score = 30.3 bits (65), Expect = 4.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP PPP PP K P P Sbjct: 139 PPPPPAPPTLVPPPPPAPPTIKPPPPPAP 167 Score = 30.3 bits (65), Expect = 4.0 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPPP P PP P P P P P P P PP Sbjct: 172 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 224 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPPP PPP PP + P P P Sbjct: 150 PPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEP 185 Score = 29.1 bits (62), Expect = 9.3 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP PPP PP + P P Sbjct: 209 PPPPPAPTELEPPPPPAPPKVELPPPPAP 237 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 I+ PPPP P PP PP P PPP P P Sbjct: 400 IEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 443 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 P PR T PP P PP P P PP P P PP Sbjct: 387 PASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTV 446 Query: 314 XXGXPPP 294 PPP Sbjct: 447 EPPPPPP 453 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 IK PPPP P PP P PP P P P P P Sbjct: 422 IKPPPPP---APPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPP 462 Score = 31.5 bits (68), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPP--XPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P PPP P P Sbjct: 414 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 30.3 bits (65), Expect = 4.0 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXF 324 + PPPPR PP P PP P P PP P PP Sbjct: 355 VNPPPPPRPASPKVE----PPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPT 410 Query: 323 FXXXXGXPPP 294 PP Sbjct: 411 LVPPPPPAPP 420 Score = 30.3 bits (65), Expect = 4.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP PPP PP K P P Sbjct: 402 PPPPPAPPTLVPPPPPAPPTIKPPPPPAP 430 Score = 30.3 bits (65), Expect = 4.0 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPPP P PP P P P P P P P PP Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPPP PPP PP + P P P Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEP 448 Score = 29.1 bits (62), Expect = 9.3 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP PPP PP + P P Sbjct: 472 PPPPPAPTELEPPPPPAPPKVELPPPPAP 500 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 I+ PPPP P PP PP P PPP P P Sbjct: 400 IEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 443 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 P PR T PP P PP P P PP P P PP Sbjct: 387 PASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTV 446 Query: 314 XXGXPPP 294 PPP Sbjct: 447 EPPPPPP 453 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 IK PPPP P PP P PP P P P P P Sbjct: 422 IKPPPPP---APPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPP 462 Score = 31.5 bits (68), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPP--XPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P PPP P P Sbjct: 414 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 30.3 bits (65), Expect = 4.0 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXF 324 + PPPPR PP P PP P P PP P PP Sbjct: 355 VNPPPPPRPASPKVE----PPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPT 410 Query: 323 FXXXXGXPPP 294 PP Sbjct: 411 LVPPPPPAPP 420 Score = 30.3 bits (65), Expect = 4.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP PPP PP K P P Sbjct: 402 PPPPPAPPTLVPPPPPAPPTIKPPPPPAP 430 Score = 30.3 bits (65), Expect = 4.0 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPPP P PP P P P P P P P PP Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPGXGRXXP 625 PPPP PPP PP + P P P Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEP 448 Score = 29.1 bits (62), Expect = 9.3 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP PPP PP + P P Sbjct: 472 PPPPPAPTELEPPPPPAPPKVELPPPPAP 500 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFX-GGXPXPXPPP 390 PPPP G P PP P P F GG P P PPP Sbjct: 384 PPPP---APPAGVPPAPP-PMPVFGAGGAPPPPPPP 415 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP G PP P PP G P PPP P Sbjct: 397 PPPMP---VFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQP 433 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFX-GGXPXPXPPP 390 PPPP G P PP P P F GG P P PPP Sbjct: 384 PPPP---APPAGVPPAPP-PMPVFGAGGAPPPPPPP 415 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP G PP P PP G P PPP P Sbjct: 397 PPPMP---VFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQP 433 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFX-GGXPXPXPPP 390 PPPP G P PP P P F GG P P PPP Sbjct: 500 PPPP---APPAGVPPAPP-PMPVFGAGGAPPPPPPP 531 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP G PP P PP G P PPP P Sbjct: 513 PPPMP---VFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQP 549 >BT030401-1|ABO52820.1| 451|Drosophila melanogaster FI01001p protein. Length = 451 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXG-PPXPXPPFXGGXPXPXPPP 390 P P+ G G P G P P PP G P P PPP Sbjct: 328 PFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPP 363 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 33.5 bits (73), Expect = 0.43 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = -2 Query: 554 SPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 +P P GG PPPP G P PP P PP G P PPP Sbjct: 206 TPTPDPMPPVGGVMVMPSPTPPPP--AGGVLVMPR-PPPPPPPAGGVLVMPPPPP 257 Score = 32.7 bits (71), Expect = 0.76 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -3 Query: 532 PXGGGVFFLX*KXPPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPP 392 P GGV + PPPPA G PR PP P P GV PP Sbjct: 213 PPVGGVMVMPSPTPPPPAGGVLVM-PR--PPPPPPPAGGVLVMPPPP 256 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPP 564 +P PP GG + + PPPP PPP Sbjct: 221 MPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPP 256 >AY071031-1|AAL48653.1| 451|Drosophila melanogaster RE11345p protein. Length = 451 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXG-PPXPXPPFXGGXPXPXPPP 390 P P+ G G P G P P PP G P P PPP Sbjct: 328 PFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPP 363 >AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p protein. Length = 463 Score = 33.5 bits (73), Expect = 0.43 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPP--RXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P G GG + + PPP G G GPP P PP P P P P Sbjct: 253 PMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGPGPGPMMGVPP 308 >AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FBgn0000810;fs(1)K10 protein. Length = 463 Score = 33.5 bits (73), Expect = 0.43 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPP--RXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P G GG + + PPP G G GPP P PP P P P P Sbjct: 253 PMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGPGPGPMMGVPP 308 >AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA protein. Length = 463 Score = 33.5 bits (73), Expect = 0.43 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPP--RXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P G GG + + PPP G G GPP P PP P P P P Sbjct: 253 PMGPGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPPPPLFMRRNGPGPGPMMGVPP 308 >AE014134-682|AAF51057.1| 451|Drosophila melanogaster CG2939-PA protein. Length = 451 Score = 33.5 bits (73), Expect = 0.43 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXG-PPXPXPPFXGGXPXPXPPP 390 P P+ G G P G P P PP G P P PPP Sbjct: 328 PFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPP 363 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 33.5 bits (73), Expect = 0.43 Identities = 20/55 (36%), Positives = 21/55 (38%) Frame = -2 Query: 554 SPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 +P P GG PPPP G P PP P PP G P PPP Sbjct: 206 TPTPDPMPPVGGVMVMPSPTPPPP--AGGVLVMPR-PPPPPPPAGGVLVMPPPPP 257 Score = 32.7 bits (71), Expect = 0.76 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -3 Query: 532 PXGGGVFFLX*KXPPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPP 392 P GGV + PPPPA G PR PP P P GV PP Sbjct: 213 PPVGGVMVMPSPTPPPPAGGVLVM-PR--PPPPPPPAGGVLVMPPPP 256 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPP 564 +P PP GG + + PPPP PPP Sbjct: 221 MPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPP 256 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 33.5 bits (73), Expect = 0.43 Identities = 27/79 (34%), Positives = 28/79 (35%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G G G F GGG+ G GG F P P GG G P Sbjct: 59 GGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGG--FANGRPIAPGGGGGGGGAPA- 115 Query: 446 PPXPXPPFXGGXPXPXPPP 390 P P P GG P PP Sbjct: 116 -PRPSPS--GGAPPTSGPP 131 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 33.5 bits (73), Expect = 0.43 Identities = 27/79 (34%), Positives = 28/79 (35%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G G G F GGG+ G GG F P P GG G P Sbjct: 59 GGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGG--FANGRPIAPGGGGGGGGAPA- 115 Query: 446 PPXPXPPFXGGXPXPXPPP 390 P P P GG P PP Sbjct: 116 -PRPSPS--GGAPPTSGPP 131 Score = 31.1 bits (67), Expect = 2.3 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -1 Query: 606 PGSXXXGXFXXGGXGGGXPXXRXXPXGGGGXFFXDKXPPPPPXXGXXXGDPGWA 445 PGS G F GG GGG GG G P P G G PG A Sbjct: 492 PGSPGGGGF--GGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGA 543 Score = 30.7 bits (66), Expect = 3.1 Identities = 24/82 (29%), Positives = 26/82 (31%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G PG G GGG+ GG PP GG G+P Sbjct: 513 GGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLPGNQYVPPAAGGGAPGSPGR 572 Query: 446 PPXPXPPFXGGXPXPXPPPXXP 381 P P G P P P P Sbjct: 573 PGSGGVPGTGSQYIP-PAPGAP 593 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = -2 Query: 488 PPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PP G P GPP P P P PPP P P + + PP Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPP-PPPPPSYPYPPYPYPPP 261 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPP-XPXPPFXGGXPXPXPP 393 PPPP P GPP P PP G P P P Sbjct: 57 PPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 P PP P PP P PP P P PPP Sbjct: 227 PGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPP 261 Score = 30.3 bits (65), Expect = 4.0 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 P G G + PPPP P P P PP+ P P P P P Sbjct: 226 PPGPPGTTYPQPPPPPPPP------PPPPPSYPYPPYPYPPPGPYPGPWIP 270 >BT016135-1|AAV37020.1| 1218|Drosophila melanogaster GH06496p protein. Length = 1218 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP G P GPP P P G P P P P Sbjct: 1173 PPPAGPPPVIGAPMGPPPPLPNRRGPPPIPNRSGNAPPLP 1212 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP--XXPXFXXXFFXXXPPXXXFF 321 PPPP + PP P PP P P PPP P PP Sbjct: 697 PPPPPMPASPTASSAAPPPPPPP---APPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPM 753 Query: 320 XXXXGXPPPXGGGXXXXP 267 PPP G P Sbjct: 754 LSSFQPPPPPVAGFMPAP 771 >AY121713-1|AAM52040.1| 959|Drosophila melanogaster SD04710p protein. Length = 959 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP G P GPP P P G P P P P Sbjct: 914 PPPAGPPPVIGAPMGPPPPLPNRRGPPPIPNRSGNAPPLP 953 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 32.3 bits (70), Expect = 1.0 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = -2 Query: 494 PPPPRXG--GXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFF 321 PPPP G G P G P PP G P PPP P PP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP--- 492 Query: 320 XXXXGXPPP 294 G PPP Sbjct: 493 SGNYGPPPP 501 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 517 PPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PPPP G G PPP P P P PP G Sbjct: 459 PPPPSGNY---GPPPPPSGNYGPPPPPSGNYGPPPPPSG 494 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 517 PPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PPPP PPP P P P PP G Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSG 474 Score = 29.5 bits (63), Expect = 7.1 Identities = 18/61 (29%), Positives = 20/61 (32%) Frame = -2 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXX 270 GPP P P G P P P P + PP + G PPP G Sbjct: 434 GPPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNY----GPPPPPSGNYGPP 489 Query: 269 P 267 P Sbjct: 490 P 490 Score = 29.5 bits (63), Expect = 7.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 517 PPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PPPP PPP P P P PP G Sbjct: 446 PPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSG 484 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 32.3 bits (70), Expect = 1.0 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = -2 Query: 494 PPPPRXG--GXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFF 321 PPPP G G P G P PP G P PPP P PP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP--- 492 Query: 320 XXXXGXPPP 294 G PPP Sbjct: 493 SGNYGPPPP 501 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 517 PPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PPPP G G PPP P P P PP G Sbjct: 459 PPPPSGNY---GPPPPPSGNYGPPPPPSGNYGPPPPPSG 494 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 517 PPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PPPP PPP P P P PP G Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSG 474 Score = 29.5 bits (63), Expect = 7.1 Identities = 18/61 (29%), Positives = 20/61 (32%) Frame = -2 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXX 270 GPP P P G P P P P + PP + G PPP G Sbjct: 434 GPPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNY----GPPPPPSGNYGPP 489 Query: 269 P 267 P Sbjct: 490 P 490 Score = 29.5 bits (63), Expect = 7.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 517 PPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 PPPP PPP P P P PP G Sbjct: 446 PPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSG 484 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = -2 Query: 488 PPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PP G P GPP P P P PPP P P + + PP Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPP-PPPPPSYPYPPYPYPPP 263 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPP-XPXPPFXGGXPXPXPP 393 PPPP P GPP P PP G P P P Sbjct: 59 PPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 P PP P PP P PP P P PPP Sbjct: 229 PGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPP 263 Score = 30.3 bits (65), Expect = 4.0 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 P G G + PPPP P P P PP+ P P P P P Sbjct: 228 PPGPPGTTYPQPPPPPPPP------PPPPPSYPYPPYPYPPPGPYPGPWIP 272 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P P R P G P P P G P P PPP P P Sbjct: 46 PDPTRPPPPPPSPPCGRPPPGSP-PPGPPPPGPPPGCPGGP 85 >AE013599-3326|AAG22194.1| 1218|Drosophila melanogaster CG6562-PB, isoform B protein. Length = 1218 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP G P GPP P P G P P P P Sbjct: 1173 PPPAGPPPVIGAPMGPPPPLPNRRGPPPIPNRSGNAPPLP 1212 >AE013599-3325|AAF46796.1| 1218|Drosophila melanogaster CG6562-PA, isoform A protein. Length = 1218 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP G P GPP P P G P P P P Sbjct: 1173 PPPAGPPPVIGAPMGPPPPLPNRRGPPPIPNRSGNAPPLP 1212 >AY058486-1|AAL13715.1| 416|Drosophila melanogaster GM13876p protein. Length = 416 Score = 31.9 bits (69), Expect = 1.3 Identities = 26/74 (35%), Positives = 27/74 (36%), Gaps = 1/74 (1%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXG-GGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPX 438 G P G G G GG P P GG + PPP GG G P GP Sbjct: 86 GQPPYMGGPGGQPPYAGGPGGQPPYVGGP--GGQPHYGGGAPPPQAFGGYPPG-PAGPGG 142 Query: 437 PXPPFXGGXPXPXP 396 P P GG P P Sbjct: 143 P-PNAFGGYPPGQP 155 Score = 29.1 bits (62), Expect = 9.3 Identities = 23/81 (28%), Positives = 25/81 (30%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXP 435 G P P + G G P P GG + PP GG G P Sbjct: 67 GYAPVPQMPPYGEAPPYGAGQPPYMGGP-GGQPPYAGGPGGQPPYVGGPGGQPHYGGGAP 125 Query: 434 XPPFXGGXPXPXPPPXXPXXP 372 P GG P P P P P Sbjct: 126 PPQAFGGYP---PGPAGPGGP 143 >AE014296-1806|AAF50165.3| 416|Drosophila melanogaster CG32056-PA, isoform A protein. Length = 416 Score = 31.9 bits (69), Expect = 1.3 Identities = 26/74 (35%), Positives = 27/74 (36%), Gaps = 1/74 (1%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXG-GGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPX 438 G P G G G GG P P GG + PPP GG G P GP Sbjct: 86 GQPPYMGGPGGQPPYAGGPGGQPPYVGGP--GGQPHYGGGAPPPQAFGGYPPG-PAGPGG 142 Query: 437 PXPPFXGGXPXPXP 396 P P GG P P Sbjct: 143 P-PNAFGGYPPGQP 155 Score = 29.1 bits (62), Expect = 9.3 Identities = 23/81 (28%), Positives = 25/81 (30%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXP 435 G P P + G G P P GG + PP GG G P Sbjct: 67 GYAPVPQMPPYGEAPPYGAGQPPYMGGP-GGQPPYAGGPGGQPPYVGGPGGQPHYGGGAP 125 Query: 434 XPPFXGGXPXPXPPPXXPXXP 372 P GG P P P P P Sbjct: 126 PPQAFGGYP---PGPAGPGGP 143 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 461 GTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 G P PP P P+ G P P PPP P P Sbjct: 82 GPPAYPPPPQRPW-GPPPPPGPPPPGPPPP 110 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 461 GTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 G P PP P P+ G P P PPP P P Sbjct: 112 GPPAYPPPPQRPW-GPPPPPGPPPPGPPPP 140 >AF184225-1|AAD55736.1| 377|Drosophila melanogaster BcDNA.GH06048 protein. Length = 377 Score = 31.5 bits (68), Expect = 1.7 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPX-GPPXPXPPFXGGXPXPXPPPXXPXXP 372 P P GG G P G P P PF GG P P P P P Sbjct: 193 PGGPSPGGPSPGGPSPGGPSPGGPFPGGSP---PSPGGPLGP 231 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 461 GTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 G P PP P P+ G P P PPP P P Sbjct: 112 GPPAYPPPPQRPW-GPPPPPGPPPPGPPPP 140 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 461 GTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 G P PP P P+ G P P PPP P P Sbjct: 82 GPPAYPPPPQRPW-GPPPPPGPPPPGPPPP 110 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 31.5 bits (68), Expect = 1.7 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 + PPPP P PP P PP P P PPP P Sbjct: 460 VHHPPPP--------PPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P PP P PPP P P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P PP P PP P PPP P P Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 >AE013599-4026|AAF47319.2| 377|Drosophila melanogaster CG2668-PA protein. Length = 377 Score = 31.5 bits (68), Expect = 1.7 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPX-GPPXPXPPFXGGXPXPXPPPXXPXXP 372 P P GG G P G P P PF GG P P P P P Sbjct: 193 PGGPSPGGPSPGGPSPGGPSPGGPFPGGSP---PSPGGPLGP 231 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 31.1 bits (67), Expect = 2.3 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -1 Query: 606 PGSXXXGXFXXGGXGGGXPXXRXXPXGGGGXFFXDKXPPPPPXXGXXXGDPGWA 445 PGS G F GG GGG GG G P P G G PG A Sbjct: 420 PGSPGGGGF--GGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGA 471 Score = 30.7 bits (66), Expect = 3.1 Identities = 24/82 (29%), Positives = 26/82 (31%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G PG G GGG+ GG PP GG G+P Sbjct: 441 GGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLPGNQYVPPAAGGGAPGSPGR 500 Query: 446 PPXPXPPFXGGXPXPXPPPXXP 381 P P G P P P P Sbjct: 501 PGSGGVPGTGSQYIP-PAPGAP 521 >BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p protein. Length = 749 Score = 31.1 bits (67), Expect = 2.3 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 5/75 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP-----PPXXPXXPXFXXXFFXXXPPXX 330 PPPP G G P P P PP P P P P F PP Sbjct: 567 PPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPG 626 Query: 329 XFFXXXXGXPPPXGG 285 + PP G Sbjct: 627 SHYMSPRPPPPQHNG 641 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 + PPPP P PP P P P PP P P Sbjct: 355 RAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP P PP P PP P P PPP Sbjct: 370 PPPPPVSAPVVAPP--PPPPPPP--AAVPPPPPPP 400 >AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p protein. Length = 457 Score = 31.1 bits (67), Expect = 2.3 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 5/75 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP-----PPXXPXXPXFXXXFFXXXPPXX 330 PPPP G G P P P PP P P P P F PP Sbjct: 275 PPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPG 334 Query: 329 XFFXXXXGXPPPXGG 285 + PP G Sbjct: 335 SHYMSPRPPPPQHNG 349 >AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protein protein. Length = 749 Score = 31.1 bits (67), Expect = 2.3 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 5/75 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP-----PPXXPXXPXFXXXFFXXXPPXX 330 PPPP G G P P P PP P P P P F PP Sbjct: 567 PPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPG 626 Query: 329 XFFXXXXGXPPPXGG 285 + PP G Sbjct: 627 SHYMSPRPPPPQHNG 641 >AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-associated protein 111kD protein. Length = 749 Score = 31.1 bits (67), Expect = 2.3 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 5/75 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP-----PPXXPXXPXFXXXFFXXXPPXX 330 PPPP G G P P P PP P P P P F PP Sbjct: 567 PPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPG 626 Query: 329 XFFXXXXGXPPPXGG 285 + PP G Sbjct: 627 SHYMSPRPPPPQHNG 641 >AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA protein. Length = 749 Score = 31.1 bits (67), Expect = 2.3 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 5/75 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP-----PPXXPXXPXFXXXFFXXXPPXX 330 PPPP G G P P P PP P P P P F PP Sbjct: 567 PPPPHTGYANYGGPPHGPPPGPPGGPARPYYQPQYGGHPTPQPYYAPFSPYQQSYGPPPG 626 Query: 329 XFFXXXXGXPPPXGG 285 + PP G Sbjct: 627 SHYMSPRPPPPQHNG 641 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 + PPPP P PP P P P PP P P Sbjct: 322 RAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 364 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP P PP P PP P P PPP Sbjct: 337 PPPPPVSAPVVAPP--PPPPPPP--AAVPPPPPPP 367 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 + PPPP P PP P P P PP P P Sbjct: 355 RAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP P PP P PP P P PPP Sbjct: 370 PPPPPVSAPVVAPP--PPPPPPP--AAVPPPPPPP 400 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 + PPPP P PP P P P PP P P Sbjct: 355 RAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP P PP P PP P P PPP Sbjct: 370 PPPPPVSAPVVAPP--PPPPPPP--AAVPPPPPPP 400 >BT016106-1|AAV36991.1| 840|Drosophila melanogaster LD20133p protein. Length = 840 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = -2 Query: 560 GGSPXXXXXPXGGGGXFFXIKXPPPPRXG-GXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GG P P G G PP+ G G P GPP PP+ G P P P Sbjct: 230 GGPPQQQQQP--GQGPVPGQPGQGPPQMGMQQHGGDPQGPPVQMPPY-GAQQQPQPHPGL 286 Query: 383 P 381 P Sbjct: 287 P 287 >BT015290-1|AAT94519.1| 313|Drosophila melanogaster GH12715p protein. Length = 313 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 11 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 54 Query: 383 PXXP 372 P Sbjct: 55 QGPP 58 >BT003175-1|AAO24930.1| 313|Drosophila melanogaster RH66362p protein. Length = 313 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 11 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 54 Query: 383 PXXP 372 P Sbjct: 55 QGPP 58 >BT001413-1|AAN71168.1| 324|Drosophila melanogaster GH11283p protein. Length = 324 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 22 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 65 Query: 383 PXXP 372 P Sbjct: 66 QGPP 69 >AY060346-1|AAL25385.1| 316|Drosophila melanogaster GH26622p protein. Length = 316 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 14 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 57 Query: 383 PXXP 372 P Sbjct: 58 QGPP 61 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = -2 Query: 560 GGSPXXXXXPXGGGGXFFXIKXPPPPRXG-GXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GG P P G G PP+ G G P GPP PP+ G P P P Sbjct: 230 GGPPQQQQQP--GQGPVPGQPGQGPPQMGMQQHGGDPQGPPVQMPPY-GAQQQPQPHPGL 286 Query: 383 P 381 P Sbjct: 287 P 287 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 30.7 bits (66), Expect = 3.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P PP P P PPP P P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPPGVP 97 >AE014297-1700|AAN13569.1| 112|Drosophila melanogaster CG9759-PB, isoform B protein. Length = 112 Score = 30.7 bits (66), Expect = 3.1 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXG 459 G G G G F GGG P GGG F PPPP GG G Sbjct: 62 GREGFGRGRGGFGGFGGRRGGGG----FRRPGFGGGGFGGFYPPPPPFFGGPFYG 112 Score = 29.1 bits (62), Expect = 9.3 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -1 Query: 624 GXXRPXPGSXXXGXFXXGGXGGGXPXXRXXPXGGG-GXFFXDKXPPPPPXXG 472 G R G G GG GG R GGG G F+ PPPPP G Sbjct: 60 GFGREGFGRGRGGFGGFGGRRGGGGFRRPGFGGGGFGGFY----PPPPPFFG 107 >AE014297-1699|AAF54958.1| 112|Drosophila melanogaster CG9759-PA, isoform A protein. Length = 112 Score = 30.7 bits (66), Expect = 3.1 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXG 459 G G G G F GGG P GGG F PPPP GG G Sbjct: 62 GREGFGRGRGGFGGFGGRRGGGG----FRRPGFGGGGFGGFYPPPPPFFGGPFYG 112 Score = 29.1 bits (62), Expect = 9.3 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -1 Query: 624 GXXRPXPGSXXXGXFXXGGXGGGXPXXRXXPXGGG-GXFFXDKXPPPPPXXG 472 G R G G GG GG R GGG G F+ PPPPP G Sbjct: 60 GFGREGFGRGRGGFGGFGGRRGGGGFRRPGFGGGGFGGFY----PPPPPFFG 107 >AE013599-1605|AAM68615.1| 316|Drosophila melanogaster CG3798-PF, isoform F protein. Length = 316 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 14 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 57 Query: 383 PXXP 372 P Sbjct: 58 QGPP 61 >AE013599-1604|AAM68616.2| 324|Drosophila melanogaster CG3798-PE, isoform E protein. Length = 324 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 22 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 65 Query: 383 PXXP 372 P Sbjct: 66 QGPP 69 >AE013599-1603|AAM68614.1| 324|Drosophila melanogaster CG3798-PD, isoform D protein. Length = 324 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 22 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 65 Query: 383 PXXP 372 P Sbjct: 66 QGPP 69 >AE013599-1602|AAF58446.1| 324|Drosophila melanogaster CG3798-PC, isoform C protein. Length = 324 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 22 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 65 Query: 383 PXXP 372 P Sbjct: 66 QGPP 69 >AE013599-1601|AAM68613.1| 313|Drosophila melanogaster CG3798-PB, isoform B protein. Length = 313 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 11 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 54 Query: 383 PXXP 372 P Sbjct: 55 QGPP 58 >AE013599-1600|AAM68612.1| 313|Drosophila melanogaster CG3798-PA, isoform A protein. Length = 313 Score = 30.7 bits (66), Expect = 3.1 Identities = 22/64 (34%), Positives = 26/64 (40%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGG+P P GG G + PP+ G P GPP PP+ G P P P Sbjct: 11 GGGNP-----PQGGYGGY-------PPQGGYP----PQGPPQGYPPYAQGGAQPYPQPYG 54 Query: 383 PXXP 372 P Sbjct: 55 QGPP 58 >BT003608-1|AAO39611.1| 377|Drosophila melanogaster GH19274p protein. Length = 377 Score = 30.3 bits (65), Expect = 4.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP 428 PPPP+ G P GPP P P Sbjct: 114 PPPPSCGSCPPPPSCGPPCPPP 135 >BT003318-1|AAO25078.1| 517|Drosophila melanogaster AT26991p protein. Length = 517 Score = 30.3 bits (65), Expect = 4.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP 428 PPPP+ G P GPP P P Sbjct: 254 PPPPSCGSCPPPPSCGPPCPPP 275 >BT001317-1|AAN71072.1| 517|Drosophila melanogaster AT15066p protein. Length = 517 Score = 30.3 bits (65), Expect = 4.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP 428 PPPP+ G P GPP P P Sbjct: 254 PPPPSCGSCPPPPSCGPPCPPP 275 >AY058563-1|AAL13792.1| 652|Drosophila melanogaster LD25239p protein. Length = 652 Score = 30.3 bits (65), Expect = 4.0 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXP---PPXGG 285 P GP PP GG P PP P P P F G P P GG Sbjct: 322 PAGPDWRRPPMHGGFPPQGPPRGLPPAPGPGGPHGAPAPHVNPAFFNQPGGPAQHPGMGG 381 Query: 284 GXXXXP 267 P Sbjct: 382 PPHGAP 387 Score = 29.5 bits (63), Expect = 7.1 Identities = 25/86 (29%), Positives = 28/86 (32%), Gaps = 7/86 (8%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGS-PXXXXXPXGGGGXFFXIKXPPP------PRXGGX 468 GG G P P + F G P P G G + PP P+ G Sbjct: 352 GGPHGA-PAPHVNPAFFNQPGGPAQHPGMGGPPHGAPGPQPGMNMPPQQGMNMTPQHGPP 410 Query: 467 XXGTPXGPPXPXPPFXGGXPXPXPPP 390 GP P PP G P P P P Sbjct: 411 PQFAQHGPRGPWPPPQGKPPGPFPDP 436 >AE014297-4154|AAF56730.2| 445|Drosophila melanogaster CG31058-PA protein. Length = 445 Score = 30.3 bits (65), Expect = 4.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXP 372 GPP P PPF G P P P P Sbjct: 207 GPPQPRPPFAGARPMVGMGPRPPMPP 232 >AE014296-1757|AAF50200.2| 734|Drosophila melanogaster CG32050-PA protein. Length = 734 Score = 30.3 bits (65), Expect = 4.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -2 Query: 458 TPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 TP P P PP P P PPP P Sbjct: 192 TPVSTPVPIPPTATATPPPPPPPPPTALP 220 >AE014296-1420|AAF50445.2| 652|Drosophila melanogaster CG7185-PA protein. Length = 652 Score = 30.3 bits (65), Expect = 4.0 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXP---PPXGG 285 P GP PP GG P PP P P P F G P P GG Sbjct: 322 PAGPDWRRPPMHGGFPPQGPPRGLPPAPGPGGPHGAPAPHVNPAFFNQPGGPAQHPGMGG 381 Query: 284 GXXXXP 267 P Sbjct: 382 PPHGAP 387 Score = 29.5 bits (63), Expect = 7.1 Identities = 25/86 (29%), Positives = 28/86 (32%), Gaps = 7/86 (8%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGS-PXXXXXPXGGGGXFFXIKXPPP------PRXGGX 468 GG G P P + F G P P G G + PP P+ G Sbjct: 352 GGPHGA-PAPHVNPAFFNQPGGPAQHPGMGGPPHGAPGPQPGMNMPPQQGMNMTPQHGPP 410 Query: 467 XXGTPXGPPXPXPPFXGGXPXPXPPP 390 GP P PP G P P P P Sbjct: 411 PQFAQHGPRGPWPPPQGKPPGPFPDP 436 >AE014296-204|AAN11465.1| 517|Drosophila melanogaster CG9130-PB, isoform B protein. Length = 517 Score = 30.3 bits (65), Expect = 4.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP 428 PPPP+ G P GPP P P Sbjct: 254 PPPPSCGSCPPPPSCGPPCPPP 275 >AE014296-203|AAN11464.1| 517|Drosophila melanogaster CG9130-PA, isoform A protein. Length = 517 Score = 30.3 bits (65), Expect = 4.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXP 428 PPPP+ G P GPP P P Sbjct: 254 PPPPSCGSCPPPPSCGPPCPPP 275 >X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal protein protein. Length = 366 Score = 29.9 bits (64), Expect = 5.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP--PXPXPPFXGGXPXPXPPPXXP 381 PPPPR P G P P PP P P P P P Sbjct: 315 PPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 354 >X59449-1|CAA42068.1| 883|Drosophila melanogaster dynamin protein. Length = 883 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 795 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 833 >X59448-1|CAA42067.1| 836|Drosophila melanogaster dynamin protein. Length = 836 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 795 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 833 >X59435-1|CAA42061.1| 836|Drosophila melanogaster dynamnin-like protein protein. Length = 836 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 795 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 833 >BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p protein. Length = 347 Score = 29.9 bits (64), Expect = 5.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP--PXPXPPFXGGXPXPXPPPXXP 381 PPPPR P G P P PP P P P P P Sbjct: 296 PPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 335 >BT010049-1|AAQ22518.1| 877|Drosophila melanogaster LD21622p protein. Length = 877 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AY118390-1|AAM48419.1| 873|Drosophila melanogaster RE39020p protein. Length = 873 Score = 29.9 bits (64), Expect = 5.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXP 402 PPPP G G P PP P P G P P Sbjct: 670 PPPPHVGHGGHGQPQPPPPPPP---HGVPHP 697 >AF210315-1|AAF19646.1| 1133|Drosophila melanogaster bonus protein. Length = 1133 Score = 29.9 bits (64), Expect = 5.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -2 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXG 288 G P P P G P P PP P P PP G P G Sbjct: 446 GKPYPPTPSPNGTPQPQHPPRQPPSPNMAPPLRPGLPPGMPAGLSPNGPPVNFG 499 >AE014298-2280|ABI30984.1| 830|Drosophila melanogaster CG18102-PI, isoform I protein. Length = 830 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AE014298-2279|ABI30983.1| 830|Drosophila melanogaster CG18102-PH, isoform H protein. Length = 830 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AE014298-2278|AAS65369.1| 830|Drosophila melanogaster CG18102-PE, isoform E protein. Length = 830 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AE014298-2277|AAN09373.1| 830|Drosophila melanogaster CG18102-PC, isoform C protein. Length = 830 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AE014298-2276|AAN09372.1| 830|Drosophila melanogaster CG18102-PB, isoform B protein. Length = 830 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AE014298-2275|AAS65368.1| 830|Drosophila melanogaster CG18102-PA, isoform A protein. Length = 830 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AE014298-2274|AAS65367.1| 877|Drosophila melanogaster CG18102-PG, isoform G protein. Length = 877 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AE014298-2273|AAS65366.1| 877|Drosophila melanogaster CG18102-PF, isoform F protein. Length = 877 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AE014298-2272|AAF48536.2| 877|Drosophila melanogaster CG18102-PD, isoform D protein. Length = 877 Score = 29.9 bits (64), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPPPXXP 381 P PP G P P PP GG P PPP P Sbjct: 789 PLPPSTGRPAPAIPNRPGGGAPPLPGGRPGGSLPPPMLP 827 >AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA protein. Length = 347 Score = 29.9 bits (64), Expect = 5.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP--PXPXPPFXGGXPXPXPPPXXP 381 PPPPR P G P P PP P P P P P Sbjct: 296 PPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 335 >AE014297-2826|AAF55786.2| 1133|Drosophila melanogaster CG5206-PA protein. Length = 1133 Score = 29.9 bits (64), Expect = 5.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -2 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXG 288 G P P P G P P PP P P PP G P G Sbjct: 446 GKPYPPTPSPNGTPQPQHPPRQPPSPNMAPPLRPGLPPGMPAGLSPNGPPVNFG 499 >AE013599-3085|AAF46639.3| 873|Drosophila melanogaster CG10052-PA protein. Length = 873 Score = 29.9 bits (64), Expect = 5.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXP 402 PPPP G G P PP P P G P P Sbjct: 670 PPPPHVGHGGHGQPQPPPPPPP---HGVPHP 697 >BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p protein. Length = 1327 Score = 29.5 bits (63), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P PP P P PPP P Sbjct: 4 PPLPPPPVQPAPPPPPPPPEEDLSP 28 >AY075095-1|AAL79357.1| 815|Drosophila melanogaster pygopus protein. Length = 815 Score = 29.5 bits (63), Expect = 7.1 Identities = 27/93 (29%), Positives = 30/93 (32%), Gaps = 6/93 (6%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGG----SPXXXXX-PXGGGGXFFXIKXPPPPRXGGX 468 P GG G P G GGG +P P GG G + P G Sbjct: 242 PMGGMGGPSISPHHMGMGGLSPMGGGPNGPNPRAMQGSPMGGPGQNSPMNSLPMGSPMGN 301 Query: 467 XXGTPXGPP-XPXPPFXGGXPXPXPPPXXPXXP 372 G+P GPP P P G P P P Sbjct: 302 PIGSPLGPPSGPGPGNPGNTGGPQQQQQQPPQP 334 >AY058500-1|AAL13729.1| 815|Drosophila melanogaster LD18280p protein. Length = 815 Score = 29.5 bits (63), Expect = 7.1 Identities = 27/93 (29%), Positives = 30/93 (32%), Gaps = 6/93 (6%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGG----SPXXXXX-PXGGGGXFFXIKXPPPPRXGGX 468 P GG G P G GGG +P P GG G + P G Sbjct: 242 PMGGMGGPSISPHHMGMGGLSPMGGGPNGPNPRAMQGSPMGGPGQNSPMNSLPMGSPMGN 301 Query: 467 XXGTPXGPP-XPXPPFXGGXPXPXPPPXXPXXP 372 G+P GPP P P G P P P Sbjct: 302 PIGSPLGPPSGPGPGNPGNTGGPQQQQQQPPQP 334 >AF457206-1|AAL91369.1| 815|Drosophila melanogaster pygopus protein. Length = 815 Score = 29.5 bits (63), Expect = 7.1 Identities = 27/93 (29%), Positives = 30/93 (32%), Gaps = 6/93 (6%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGG----SPXXXXX-PXGGGGXFFXIKXPPPPRXGGX 468 P GG G P G GGG +P P GG G + P G Sbjct: 242 PMGGMGGPSISPHHMGMGGLSPMGGGPNGPNPRAMQGSPMGGPGQNSPMNSLPMGSPMGN 301 Query: 467 XXGTPXGPP-XPXPPFXGGXPXPXPPPXXPXXP 372 G+P GPP P P G P P P Sbjct: 302 PIGSPLGPPSGPGPGNPGNTGGPQQQQQQPPQP 334 >AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease protein. Length = 1327 Score = 29.5 bits (63), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P PP P P PPP P Sbjct: 4 PPLPPPPVQPAPPPPPPPPEEDLSP 28 >AF017777-12|AAC28405.1| 145|Drosophila melanogaster la costa protein. Length = 145 Score = 29.5 bits (63), Expect = 7.1 Identities = 27/81 (33%), Positives = 27/81 (33%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTP 453 P G G PG G GG P P G GG P GG G P Sbjct: 35 PGRGRGGPGRGPGGPGG-----PGGRGPGGPGGPGGPGG---------PGGPGGP--GGP 78 Query: 452 XGPPXPXPPFXGGXPXPXPPP 390 GP P P G P P PP Sbjct: 79 GGPGCPGGPGGPGGPKPWGPP 99 Score = 29.1 bits (62), Expect = 9.3 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = -1 Query: 624 GXXRPXPGSXXXGXFXXGGXGGGXPXXRXXPXGGGGXFFXDKXPPP--PPXXGXXXGDPG 451 G R PG G GG G G P P G GG P P G G Sbjct: 36 GRGRGGPGRGPGGPGGPGGRGPGGPGGPGGPGGPGGPGGPGGPGGPGCPGGPGGPGGPKP 95 Query: 450 WAP 442 W P Sbjct: 96 WGP 98 >AE014298-3140|AAF50816.1| 145|Drosophila melanogaster CG12794-PA protein. Length = 145 Score = 29.5 bits (63), Expect = 7.1 Identities = 27/81 (33%), Positives = 27/81 (33%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTP 453 P G G PG G GG P P G GG P GG G P Sbjct: 35 PGRGRGGPGRGPGGPGG-----PGGRGPGGPGGPGGPGG---------PGGPGGP--GGP 78 Query: 452 XGPPXPXPPFXGGXPXPXPPP 390 GP P P G P P PP Sbjct: 79 GGPGCPGGPGGPGGPKPWGPP 99 Score = 29.1 bits (62), Expect = 9.3 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = -1 Query: 624 GXXRPXPGSXXXGXFXXGGXGGGXPXXRXXPXGGGGXFFXDKXPPP--PPXXGXXXGDPG 451 G R PG G GG G G P P G GG P P G G Sbjct: 36 GRGRGGPGRGPGGPGGPGGRGPGGPGGPGGPGGPGGPGGPGGPGGPGCPGGPGGPGGPKP 95 Query: 450 WAP 442 W P Sbjct: 96 WGP 98 >AE014297-4758|AAF57161.1| 815|Drosophila melanogaster CG11518-PA protein. Length = 815 Score = 29.5 bits (63), Expect = 7.1 Identities = 27/93 (29%), Positives = 30/93 (32%), Gaps = 6/93 (6%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXGGG----SPXXXXX-PXGGGGXFFXIKXPPPPRXGGX 468 P GG G P G GGG +P P GG G + P G Sbjct: 242 PMGGMGGPSISPHHMGMGGLSPMGGGPNGPNPRAMQGSPMGGPGQNSPMNSLPMGSPMGN 301 Query: 467 XXGTPXGPP-XPXPPFXGGXPXPXPPPXXPXXP 372 G+P GPP P P G P P P Sbjct: 302 PIGSPLGPPSGPGPGNPGNTGGPQQQQQQPPQP 334 >AE014297-116|AAF52115.2| 559|Drosophila melanogaster CG12586-PA protein. Length = 559 Score = 29.5 bits (63), Expect = 7.1 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = -2 Query: 557 GSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPX 378 G P P G GG P GG G P GP P P+ G P P P Sbjct: 380 GRPGAPGGPNGPGGPMGPGGPGGPGGPGGP--GGPGGPGGPGMPWGPGGPGGPGGPNGPG 437 Query: 377 XP 372 P Sbjct: 438 GP 439 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 29.5 bits (63), Expect = 7.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P PP+ P PPP P P Sbjct: 187 PPPPPPPYYPPYPYYPPPPPPPPLP 211 >AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA protein. Length = 1327 Score = 29.5 bits (63), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P PP P P PPP P Sbjct: 4 PPLPPPPVQPAPPPPPPPPEEDLSP 28 >X54251-1|CAA38152.1| 1596|Drosophila melanogaster nuclear protein protein. Length = 1596 Score = 29.1 bits (62), Expect = 9.3 Identities = 18/68 (26%), Positives = 24/68 (35%) Frame = +3 Query: 291 GGGGXPPXXXKKXXXGGXPXKKXXXKXXXXRXXRGGXXXGXTPXKRGXGXGGPXRGPXXL 470 GGGG G ++ + + +GG G RG G GG GP + Sbjct: 373 GGGGGGGNGNNNNNGGDHHQQQQQHQHQQQQQQQGGGLGGLGNNGRGGGPGGMATGPGGV 432 Query: 471 XPXAGGGG 494 GG G Sbjct: 433 AGGLGGMG 440 >BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p protein. Length = 195 Score = 29.1 bits (62), Expect = 9.3 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = -2 Query: 512 FFXIKXPPPPRXGGXXXGTPX-GPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXP 339 ++ I PPP+ G P PP P PPF P P P P P F P Sbjct: 34 YYPIYALPPPQ------GPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPP 86 >AY113619-1|AAM29624.1| 65|Drosophila melanogaster RH67809p protein. Length = 65 Score = 29.1 bits (62), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -2 Query: 509 FXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP 396 F + P P G GTP P P P GG P P Sbjct: 20 FAVAYPQGPGCGPPPSGTPPSGPRPSGPPPGGRCGPPP 57 >AY113393-1|AAM29398.1| 891|Drosophila melanogaster RE07247p protein. Length = 891 Score = 29.1 bits (62), Expect = 9.3 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP--PXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXP 339 PPPP G P GP P P P + G P PP P F P Sbjct: 143 PPPP---SGFSGGPYGPAKPMPPPSYFSGRPPMGGPPGSYGPPPSSLNSFGPPP 193 >AE014298-1043|AAF46262.2| 65|Drosophila melanogaster CG11368-PA protein. Length = 65 Score = 29.1 bits (62), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -2 Query: 509 FXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP 396 F + P P G GTP P P P GG P P Sbjct: 20 FAVAYPQGPGCGPPPSGTPPSGPRPSGPPPGGRCGPPP 57 >AE014296-2707|AAF49484.2| 891|Drosophila melanogaster CG4998-PA, isoform A protein. Length = 891 Score = 29.1 bits (62), Expect = 9.3 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP--PXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXP 339 PPPP G P GP P P P + G P PP P F P Sbjct: 143 PPPP---SGFSGGPYGPAKPMPPPSYFSGRPPMGGPPGSYGPPPSSLNSFGPPP 193 >AE014296-2706|ABI31256.1| 1185|Drosophila melanogaster CG4998-PB, isoform B protein. Length = 1185 Score = 29.1 bits (62), Expect = 9.3 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP--PXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXP 339 PPPP G P GP P P P + G P PP P F P Sbjct: 143 PPPP---SGFSGGPYGPAKPMPPPSYFSGRPPMGGPPGSYGPPPSSLNSFGPPP 193 >AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA protein. Length = 575 Score = 29.1 bits (62), Expect = 9.3 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = -2 Query: 512 FFXIKXPPPPRXGGXXXGTPX-GPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXP 339 ++ I PPP+ G P PP P PPF P P P P P F P Sbjct: 34 YYPIYALPPPQ------GPPYPAPPPPPPPFQPIGPLIPPQPALPSTPAVIPTFQPTPP 86 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.310 0.156 0.527 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,280,907 Number of Sequences: 53049 Number of extensions: 850446 Number of successful extensions: 5844 Number of sequences better than 10.0: 143 Number of HSP's better than 10.0 without gapping: 1231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3683 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4710216690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -