BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F11 (948 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 44 1e-04 At1g61080.1 68414.m06877 proline-rich family protein 42 8e-04 At1g15830.1 68414.m01900 expressed protein 39 0.006 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 38 0.010 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 36 0.039 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 36 0.039 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 36 0.052 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 35 0.069 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 35 0.069 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 35 0.069 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 35 0.069 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 35 0.069 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 34 0.12 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 34 0.12 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 33 0.28 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 33 0.37 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 33 0.37 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 32 0.48 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 32 0.48 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 32 0.48 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 32 0.64 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 31 0.85 At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family... 31 0.85 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 31 0.85 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 31 1.1 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 31 1.1 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 31 1.1 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 31 1.1 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 31 1.1 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 31 1.1 At1g70985.1 68414.m08189 hydroxyproline-rich glycoprotein family... 31 1.1 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 31 1.1 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 31 1.1 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 31 1.5 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 31 1.5 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 30 2.0 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 30 2.0 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 30 2.0 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 30 2.0 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 30 2.0 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 30 2.0 At5g51300.2 68418.m06360 splicing factor-related contains simila... 30 2.6 At5g51300.1 68418.m06359 splicing factor-related contains simila... 30 2.6 At1g64450.1 68414.m07306 proline-rich family protein contains pr... 30 2.6 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 30 2.6 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 29 3.4 At4g33660.1 68417.m04781 expressed protein 29 3.4 At4g18570.1 68417.m02749 proline-rich family protein common fami... 29 3.4 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 29 3.4 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 29 3.4 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 3.4 At3g08530.1 68416.m00990 clathrin heavy chain, putative similar ... 29 4.5 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 29 4.5 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 4.5 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 29 4.5 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 6.0 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 29 6.0 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 29 6.0 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 29 6.0 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 29 6.0 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 6.0 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 28 7.9 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 28 7.9 At5g07570.1 68418.m00867 glycine/proline-rich protein contains s... 28 7.9 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 28 7.9 At1g51580.1 68414.m05806 KH domain-containing protein 28 7.9 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 28 7.9 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/67 (32%), Positives = 25/67 (37%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP +P PP P PP P P PPP P P + PP + Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSP 497 Query: 314 XXGXPPP 294 PPP Sbjct: 498 PPPPPPP 504 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPPP P PP P PP P P PPP P + PP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Score = 36.7 bits (81), Expect = 0.022 Identities = 20/67 (29%), Positives = 22/67 (32%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P P + P P PPP P PP + Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP--PPPPPPPVYSPP 483 Query: 314 XXGXPPP 294 PPP Sbjct: 484 PPSPPPP 490 Score = 35.1 bits (77), Expect = 0.069 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPPP P PP P P + P P PPP P + PP Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/67 (31%), Positives = 23/67 (34%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP T PP P PP P P PPP P + PP + Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPP---PPPVYSPPPPPPPPPPPPVYSP 466 Query: 314 XXGXPPP 294 PPP Sbjct: 467 PPPPPPP 473 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/69 (24%), Positives = 22/69 (31%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXF 324 + PPP P P P PP P P PP P ++ PP + Sbjct: 598 VSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVY 657 Query: 323 FXXXXGXPP 297 + PP Sbjct: 658 YSSPPPPPP 666 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/80 (28%), Positives = 26/80 (32%), Gaps = 13/80 (16%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX----PXPPFXGGXP-----XPXPPPXXPXXPXF----XXXF 354 PPPP +P PP P PP P P PPP P P F + Sbjct: 499 PPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPY 558 Query: 353 FXXXPPXXXFFXXXXGXPPP 294 + PP PPP Sbjct: 559 YYSSPPPPHSSPPPHSPPPP 578 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/45 (31%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = -2 Query: 494 PPPPRXGGXXXGTPX--GPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 PPPP P PP P P+ P P P P P + Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVY 607 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P P PP P P PP P P + PP + Sbjct: 581 PPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHY-- 638 Query: 314 XXGXPPP 294 PPP Sbjct: 639 -SSPPPP 644 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPPP P PP P P + P P P P + PP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPP 539 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 PPPP+ P P PP P PPP P P + Sbjct: 545 PPPPQFSPPPP-EPYYYSSPPPPHSSPPPHSPPPPHSPPPPIY 586 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 41.5 bits (93), Expect = 8e-04 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPP G G P PP P P G P P PPP PP Sbjct: 577 PPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGP---PPPPPRMGMANG 633 Query: 314 XXGXPPPXGGGXXXXP 267 G PPP G P Sbjct: 634 AAGPPPPPGAARSLRP 649 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P PP P G P P PPP P PP Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPP----MPLANGATPPPPPPPMAMANG 617 Query: 314 XXGXPPP 294 G PPP Sbjct: 618 AAGPPPP 624 Score = 32.7 bits (71), Expect = 0.37 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP----XXPXXPXFXXXFFXXXPP 336 I PPPP P PP P P P P PPP P P PP Sbjct: 520 IAAPPPPPPPPRAAVAPP-PPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Query: 335 XXXFFXXXXGXPPP 294 G PPP Sbjct: 579 PMPMGNSGSGGPPP 592 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPP----FXGGXPXPXPPPXXP 381 PPPP PP P PP G P P PPP P Sbjct: 476 PPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLP 517 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXG-GXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPPP P P P PP P PPP P P PP Sbjct: 423 PPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPP 476 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = -2 Query: 494 PPPPRXGGXXXGT--PXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P G+ P PP P P P P PPP P Sbjct: 494 PPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAP 536 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPP T PP P PP P PPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPP 541 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 7/59 (11%) Frame = +1 Query: 472 PPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXP-------GXGXXPXXPP 627 PP G PPPP G PPP + P P G G P PP Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPP 595 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 38.7 bits (86), Expect = 0.006 Identities = 29/81 (35%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGGGSPXXXXXP---XGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G P + G GGG P P GGGG PPP R GG G P P Sbjct: 128 GGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGG---GEPVIP 184 Query: 443 PXPXPPFXGGXPXPXPPPXXP 381 P PP GG P P P Sbjct: 185 GAP-PPKRGGGGEPVIPGAPP 204 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPP---XGXXXXXGXPPPXXXXXKXPXXPG 600 +P PP RGGGG + PPP G G PPP P PG Sbjct: 135 IPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPG 185 Score = 37.5 bits (83), Expect = 0.013 Identities = 29/81 (35%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGGGSPXXXXXP---XGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G P + G GGG P P GGGG PPP R GG G P P Sbjct: 144 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGG---GEPVIP 200 Query: 443 PXPXPPFXGGXPXPXPPPXXP 381 P PP GG P P P Sbjct: 201 GAP-PPKRGGGGEPVIPGAPP 220 Score = 37.5 bits (83), Expect = 0.013 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPP---XGXXXXXGXPPPXXXXXKXPXXPG 600 +P PP RGGGG + PPP G G PPP P PG Sbjct: 167 IPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPG 217 Score = 36.3 bits (80), Expect = 0.030 Identities = 28/77 (36%), Positives = 29/77 (37%), Gaps = 3/77 (3%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGGGSPXXXXXP---XGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G P + G GGG P P GGGG PPP R GG G P P Sbjct: 160 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGG---GEPVIP 216 Query: 443 PXPXPPFXGGXPXPXPP 393 P PP GG P P Sbjct: 217 GAP-PPKRGGGGEPVIP 232 Score = 35.9 bits (79), Expect = 0.039 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPP---XGXXXXXGXPPPXXXXXKXPXXPG 600 +P PP RGGGG PPP G G PPP P PG Sbjct: 119 IPGAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPG 169 Score = 35.9 bits (79), Expect = 0.039 Identities = 28/80 (35%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGGGSPXXXXXP---XGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G P + G GGG P P GGGG PPP R GG G P P Sbjct: 176 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGG---GEPVIP 232 Query: 443 PXPXPPFXGGXP--XPXPPP 390 P P GG P PP Sbjct: 233 GAPLPKRGGGGESVVPGAPP 252 Score = 33.9 bits (74), Expect = 0.16 Identities = 30/98 (30%), Positives = 30/98 (30%), Gaps = 4/98 (4%) Frame = -2 Query: 563 GGGSPXXXXXPXGG-GGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPX 387 GGG P P GG I PPP GG G P P P P GG P Sbjct: 98 GGGEPVIPGAPPPNRGGGETVIPGAPPPIRGG--GGEPAIPGAPPPKRGGGGEPVIPGAP 155 Query: 386 XPXXPXFXXXFFXXXPP---XXXFFXXXXGXPPPXGGG 282 P PP G PPP GG Sbjct: 156 PPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGG 193 Score = 33.9 bits (74), Expect = 0.16 Identities = 27/87 (31%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXF 354 P GGG I PPP+ GG G P P P P GG P P Sbjct: 125 PIRGGGGEPAIPGAPPPKRGG--GGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPV 182 Query: 353 FXXXPP---XXXFFXXXXGXPPPXGGG 282 PP G PPP GG Sbjct: 183 IPGAPPPKRGGGGEPVIPGAPPPKRGG 209 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 457 VPXXXPPXRGGGGXFIXKKXPP--PPXGXXXXXGXPPPXXXXXKXPXXPG 600 +P PP RGGG I PP G G PPP P PG Sbjct: 104 IPGAPPPNRGGGETVIPGAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPG 153 Score = 31.9 bits (69), Expect = 0.64 Identities = 31/119 (26%), Positives = 34/119 (28%), Gaps = 4/119 (3%) Frame = +1 Query: 283 PPPX--GGGXPXXXKKKXXXGGXXXKKXXXKXGXXGXXGGGXGXGXXXXXXXXXXXXXXG 456 PPP GGG P G + GGG Sbjct: 139 PPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPV 198 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXG--XXPXXPP 627 +P PP RGGGG + PPP G G P P G G P PP Sbjct: 199 IPGAPPPKRGGGGEPVIPGAPPPKRG-----GGGEPVIPGAPLPKRGGGGESVVPGAPP 252 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 524 GGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 GGG I PPP GG P P PP GG P P P Sbjct: 97 GGGGEPVIPGAPPPNRGGGETVIPGAP----PPIRGGGGEPAIPGAPP 140 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 481 RGGGGXFIXKKXPPP--PXGXXXXXGXPPPXXXXXKXPXXPG 600 RGGGG + PPP G G PPP P PG Sbjct: 96 RGGGGEPVIPGAPPPNRGGGETVIPGAPPPIRGGGGEPAIPG 137 Score = 29.9 bits (64), Expect = 2.6 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 3/70 (4%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGGGSPXXXXXPX---GGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G P + G GGG P P GGGG PPP R GG G Sbjct: 208 GGGGEPVIPGAPPPKRGGGGEPVIPGAPLPKRGGGGESVVPGAPPPKRGGGVIVN---GG 264 Query: 443 PXPXPPFXGG 414 PP GG Sbjct: 265 CETVPPGRGG 274 Score = 28.3 bits (60), Expect = 7.9 Identities = 22/86 (25%), Positives = 25/86 (29%), Gaps = 2/86 (2%) Frame = +1 Query: 283 PPPX--GGGXPXXXKKKXXXGGXXXKKXXXKXGXXGXXGGGXGXGXXXXXXXXXXXXXXG 456 PPP GGG P G + GGG Sbjct: 171 PPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPV 230 Query: 457 VPXXXPPXRGGGGXFIXKKXPPPPXG 534 +P P RGGGG + PPP G Sbjct: 231 IPGAPLPKRGGGGESVVPGAPPPKRG 256 Score = 28.3 bits (60), Expect = 7.9 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 2/69 (2%) Frame = -2 Query: 614 GXXPXPGLXGXFXXXXXGGGSPXXXXXPXG--GGGXFFXIKXPPPPRXGGXXXGTPXGPP 441 G P + G GGG P P GGG I P P+ GG G P Sbjct: 192 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPLPKRGGGGESVVPGAP 251 Query: 440 XPXPPFXGG 414 PP GG Sbjct: 252 ---PPKRGG 257 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -2 Query: 524 GGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 GGG + PP GG P P PP GG P P PPP Sbjct: 660 GGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 35.9 bits (79), Expect = 0.039 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPR G T P PP GG P P PPP P Sbjct: 654 PPPRSAGGGKSTNL--PSARPPLPGGGPPPPPPPPGGGPP 691 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +1 Query: 457 VPXXXPPXRGGG-GXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 VP P GGG + PP P G PPP P PG G P PP G Sbjct: 651 VPRPPPRSAGGGKSTNLPSARPPLPGGGP----PPPPPPPGGGPPPPPGGGPPPPPPPPG 706 Score = 31.9 bits (69), Expect = 0.64 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 533 PXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXG 417 P GGG PPPP GG P G P P PP G Sbjct: 673 PLPGGGP-----PPPPPPPGGGPPPPPGGGPPPPPPPPG 706 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/59 (30%), Positives = 21/59 (35%) Frame = -2 Query: 473 GXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPP 297 G +P PP P PP P P PPP P P + PP + PP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 35.5 bits (78), Expect = 0.052 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 PPPP P PP P PP P PPP P P + Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPY 423 Score = 31.9 bits (69), Expect = 0.64 Identities = 18/70 (25%), Positives = 20/70 (28%) Frame = -2 Query: 509 FXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXX 330 F P PP P PP P PP P P P P P + PP Sbjct: 372 FGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Query: 329 XFFXXXXGXP 300 + P Sbjct: 432 YVYPPPPSPP 441 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX----PXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPPP P PP P PP P P PP P P + PP Sbjct: 404 PPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 28.3 bits (60), Expect = 7.9 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 1/68 (1%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP-XXPXFXXXFFXXXPPXXXFFX 318 PPPP P PP PP+ P P PP P P + PP + Sbjct: 387 PPPPPPPPPPPPPPPPPPP--PPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVY 444 Query: 317 XXXGXPPP 294 PPP Sbjct: 445 P---PPPP 449 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 35.9 bits (79), Expect = 0.039 Identities = 29/97 (29%), Positives = 31/97 (31%), Gaps = 2/97 (2%) Frame = -2 Query: 623 GXXGXXPXPGLXGX--FXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPX 450 G G PG+ G F SP P G F + P PP GG Sbjct: 115 GIPGIPGLPGIPGSPGFRLPFPFPSSPGGGSIPGIPGSPGFRLPFPFPPSGGGIPGLPLP 174 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXP 339 PP P P G P P PP P F F P Sbjct: 175 FPPLP-PVTIPGLPLPFPPLPPVTIPSFPGFRFPPLP 210 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 35.5 bits (78), Expect = 0.052 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP+ G P PP P PP G P PPP P Sbjct: 398 PPPPKKG------PAAPPPPPPPGKKGAGPPPPPPMSKKGP 432 Score = 31.5 bits (68), Expect = 0.85 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 518 GXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 G F PP P G T PP P PP P P PP P P Sbjct: 364 GQFTTANAPPAPP--GPANQT--SPPPPPPPSAAAPPPPPPPKKGPAAP 408 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPPL 389 PPPP K GP PP P P G P PP+ Sbjct: 395 PPPPPP--PKKGPAAPPPPPPPGKKGAGPPPPPPM 427 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXPG 607 PPPP + PPP PP K PG Sbjct: 408 PPPPPPPGKKGAGPPPPPPMSKKGPPKPPG 437 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP G GPP P P G P P P P Sbjct: 408 PPPPPPPGKKGA---GPPPPPPMSKKGPPKPPGNPKGP 442 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 5/52 (9%) Frame = +1 Query: 493 GXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXP-----GXGXXPXXPPXG 633 G F PP P G PPP P P G P PP G Sbjct: 364 GQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPG 415 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PP P G PPP PP P P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPP 400 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP + PP P PP G P PPP Sbjct: 384 PPPPPP-----PSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 460 PXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXP 615 P PP +G PPPP G PPP P PG P Sbjct: 396 PPPPPPKKGPAAP-----PPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PP P P PP P PP G P P PPP Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 31.5 bits (68), Expect = 0.85 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -2 Query: 494 PPPPRXGGXXX---GTPXGPPXPXPPFXGGX-PXPXPPPXXPXXP 372 PPPP G P PP PP GG P P P P P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPP--XPXPPFXGGXPXPXPP 393 PPP GG P GP P PP G P PP Sbjct: 393 PPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP G PP PP K P+ P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PP P P PP P PP G P P PPP Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 31.5 bits (68), Expect = 0.85 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -2 Query: 494 PPPPRXGGXXX---GTPXGPPXPXPPFXGGX-PXPXPPPXXPXXP 372 PPPP G P PP PP GG P P P P P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPP--XPXPPFXGGXPXPXPP 393 PPP GG P GP P PP G P PP Sbjct: 393 PPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP G PP PP K P+ P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 35.1 bits (77), Expect = 0.069 Identities = 27/76 (35%), Positives = 29/76 (38%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GGGS P GG K PPP GG P PP+ G P PPP Sbjct: 75 GGGSSYYYPPPSQSGGGS---KYPPPYGGGGQGYYYP-------PPYSGN--YPTPPPPN 122 Query: 383 PXXPXFXXXFFXXXPP 336 P P F F+ PP Sbjct: 123 PIVPYF--PFYYHTPP 136 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXP 402 GGGS P GGGG + PPP G P P P PF P P Sbjct: 89 GGGSKYPP--PYGGGGQGYYY---PPPYSGNYPTPPPPNPIVPYFPFYYHTPPP 137 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP T PP P PP GG PP Sbjct: 50 PPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPP 84 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/55 (29%), Positives = 18/55 (32%) Frame = -2 Query: 446 PPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGG 282 PP P PP PPP P ++ P PPP GGG Sbjct: 50 PPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQS---GGGSKYPPPYGGG 101 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 35.1 bits (77), Expect = 0.069 Identities = 24/77 (31%), Positives = 27/77 (35%), Gaps = 4/77 (5%) Frame = -2 Query: 554 SPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPP----XPXPPFXGGXPXPXPPPX 387 SP GGG + PPP GG P G PP+ G PPP Sbjct: 50 SPPPPPPSSSGGGGSYYYSPPPPSSSGGVKYPPPYGGDGYGGYYPPPYYGN--YGTPPPP 107 Query: 386 XPXXPXFXXXFFXXXPP 336 P P F F+ PP Sbjct: 108 NPIVPYF--PFYYHTPP 122 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 35.1 bits (77), Expect = 0.069 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXG--GXPXPXPPP---XXPXXPXFXXXFFXXXPPXX 330 PPPP+ P PP P PP G P P PPP P P PP Sbjct: 685 PPPPKANISNAPKPPAPP-PLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Query: 329 XFFXXXXGXPPPXGGGXXXXP 267 PPP G P Sbjct: 744 GLGRGTSSGPPPLGAKGSNAP 764 Score = 34.3 bits (75), Expect = 0.12 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = -2 Query: 494 PPPP--RXGGXXXGTPXGPPXPXPPFXGGXPXPXP-PPXXPXXPXFXXXFFXXXPPXXXF 324 PPPP G G P PP P PP P PP P P PP Sbjct: 662 PPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Query: 323 FXXXXGXPPP 294 PPP Sbjct: 722 LSKTPAPPPP 731 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPX-PPPXXPXXPXF 366 PPPPR PP P PP P P PPP P P F Sbjct: 594 PPPPRPP---------PPPPPPPSSRSIPSPSAPPPPPPPPPSF 628 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 7/45 (15%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXG-------GXPXPXPPPXXP 381 PPPP + PP P PP G P P PPP P Sbjct: 604 PPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPF--XGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PPP P PP P P F G PPP P P PP Sbjct: 605 PPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPP 659 Score = 29.9 bits (64), Expect = 2.6 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 5/72 (6%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXG----GXP-XPXPPPXXPXXPXFXXXFFXXXPPXX 330 PPPP P PP P G G P P PPP P PP Sbjct: 645 PPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPL 704 Query: 329 XFFXXXXGXPPP 294 G PPP Sbjct: 705 PPSSTRLGAPPP 716 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 9/44 (20%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPP---------FXGGXPXPXPPP 390 PPPP +P PP P PP F P P PPP Sbjct: 488 PPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = -2 Query: 494 PPPPRX---GGXXXGTPXGPPXPXPP--FXGGXPXPXPPPXXP 381 PPPP G P PP P PP P PPP P Sbjct: 623 PPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP 393 K P PP G GT GPP P P P PP Sbjct: 735 KTPVPPPPPGLGRGTSSGPP-PLGAKGSNAPPPPPP 769 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP PP PP P P PPP P Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIP 613 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXF 366 + PPPP P PP P PP P P PPP P P F Sbjct: 61 VDEPPPP--------PPTSPPPPSPP-PPSPPPPSPPPPSPPPPAF 97 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX-PXPPFXGGXPX-PXPPPXXPXXPXF 366 PPPP TP PP P PP P P PPP P P + Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNY 93 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP TP PP P P P P PPP Sbjct: 246 PPPPPIPVKQSATP--PPPPPPKLKNNGPSPPPPP 278 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPP P P P PP P P PPP P Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/68 (25%), Positives = 23/68 (33%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPPLXXRXXXFFXXLFXXGXPPXXFFFXX 314 PPPP P PP P + V PP ++ + PP ++ Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPP----SPVYYPPVTQSPPPPSPVYYPP 577 Query: 313 XGGXPPPP 290 PPPP Sbjct: 578 VTNSPPPP 585 Score = 32.3 bits (70), Expect = 0.48 Identities = 19/67 (28%), Positives = 22/67 (32%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P P PP+ P P PP P P PP ++ Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPE------SSPPPPVVYYAP 547 Query: 314 XXGXPPP 294 PPP Sbjct: 548 VTQSPPP 554 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/89 (23%), Positives = 29/89 (32%), Gaps = 1/89 (1%) Frame = -3 Query: 553 PXXXXXXPXGGGVFFLX*KXPPPPAXGXXKXGPRXGPPXPXPL-FXGVXPXXXPPLXXRX 377 P P V++ PPP PP P PL + V P PP Sbjct: 576 PPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPP----S 631 Query: 376 XXFFXXLFXXGXPPXXFFFXXXGGXPPPP 290 ++ + PP ++ PPPP Sbjct: 632 PVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 28.3 bits (60), Expect = 7.9 Identities = 20/89 (22%), Positives = 29/89 (32%), Gaps = 1/89 (1%) Frame = -3 Query: 553 PXXXXXXPXGGGVFFLX*KXPPPPAXGXXKXGPRXGPPXPXPLFXG-VXPXXXPPLXXRX 377 P P V++ PPP PP P P++ V P PP Sbjct: 591 PPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPP----S 646 Query: 376 XXFFXXLFXXGXPPXXFFFXXXGGXPPPP 290 ++ + PP ++ PPPP Sbjct: 647 PVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 Score = 28.3 bits (60), Expect = 7.9 Identities = 19/67 (28%), Positives = 22/67 (32%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP P P P PP P P P P P + PP ++ Sbjct: 627 PPPPSP----VYYPPVTPSPPPPSPVYYP-PVTPSPPPPSPVYYPSETQSPPPPTEYYYS 681 Query: 314 XXGXPPP 294 PPP Sbjct: 682 PSQSPPP 688 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PPPP P PP P PP P P PPP Sbjct: 26 PPPPPPPPMRRRAPLPPP-PPPPMRRRAPLPPPPP 59 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXX 276 P PP P PP P P PPP P PP PPP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPP-----PPMRRRAPLPPPPPPAMRRRVLPRPPPP---PP 75 Query: 275 XXPXFXXXXFCLGTPP 228 P F C PP Sbjct: 76 PLPMFDAEVLCCCYPP 91 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 32.3 bits (70), Expect = 0.48 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 +K PPPP TP PP P P+ P PPP P Sbjct: 111 VKPPPPPTVKPPPPPTPYTPP-PPTPYTPPPPTVKPPPPPVVTP 153 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 +K PPPP T PP P P+ P P PP P Sbjct: 103 VKPPPPPYVKPPPPPT-VKPPPPPTPYTPPPPTPYTPPPPTVKP 145 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGP-PXPXPPFXGGXPXPXPPPXXP 381 +K PPPP TP P P P P P P PPP P Sbjct: 143 VKPPPPPVV------TPPPPTPTPEAPCPPPPPTPYPPPPKP 178 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P PP P PP P PPP P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLP 101 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 GGG P P P PP P PP P P PP P P Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 P P P PP P PP P P PP P P Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP P PP P PP P PPP P P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPP---SPPPSPPPPQLPPPP 98 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PP P P PP P P P P PP P P Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP P PP P PP P P PP P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQL--PPPPQLPPPAPPKP 108 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 31.9 bits (69), Expect = 0.64 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = -2 Query: 563 GGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXX 384 GG P P GG P PP TP P P P P P P Sbjct: 504 GGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPT 563 Query: 383 PXXP 372 P P Sbjct: 564 PSTP 567 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 31.5 bits (68), Expect = 0.85 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P P P PP P P PP P Sbjct: 44 PPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 >At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 161 Score = 31.5 bits (68), Expect = 0.85 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -2 Query: 551 PXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXP-XPXPP 393 P P GGG + PPP G TP G PP G P P PP Sbjct: 35 PCYPTPPIGGGSSTPSMTQPPPYPPPGVNYPTPAGNLPNYPPPVGNIPNYPSPP 88 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPP+ P P P PP P P PPP P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPP-PKPQPKPVPPPACPPTP 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXX 312 PPP+ P PP P P P P P P P P PP Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVP 113 Query: 311 XGXPPP 294 PPP Sbjct: 114 PHGPPP 119 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXP---PFXGGXPXPXPPPXXPXXP 372 K PPP +P PP P P P G P P P P P Sbjct: 86 KPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSP 131 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPP 574 PPPP G R PPP PP Sbjct: 777 PPPPLGQTRAPSAPPPPPP 795 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPX--PXPP---FXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P P PPP P P Sbjct: 694 PPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPP---FXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 + PPP P PP P PP P PPP P P PP Sbjct: 672 RSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPP 729 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXP-----XPPPXXPXXP 372 + PPPP T P P PP P P PPP P P Sbjct: 688 RPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPP 735 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPP 336 PP P+ G P P PP PPP P P PP Sbjct: 739 PPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPP 791 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = +3 Query: 291 GGGGXPPXXXKKXXXGGXPXKKXXXKXXXXRXXRGGXXXGXTPXKRGXGXGGPXRG--PX 464 GGGG P GG K GG G G G GGP G P Sbjct: 348 GGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGG---GGGGGGGGGPMSGGLPP 404 Query: 465 XLXPXAGGGG 494 P GGGG Sbjct: 405 GFRPMGGGGG 414 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPP 392 PPPPA P PP P P++ P PP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPP 629 Score = 28.3 bits (60), Expect = 7.9 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPX--PXPPFXGGXPXPX--PPPXXPXXPXFXXXFFXXXPP 336 + PPPP P PP P PP P P PPP P F PP Sbjct: 523 VNSPPPP----VYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Query: 335 XXXFFXXXXGXPPP 294 PPP Sbjct: 579 VYSPPPPVHSPPPP 592 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +1 Query: 508 KKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXGXXPXXPPXG 633 + PPPP PPP + P P P PP G Sbjct: 262 RSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKG 303 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P P P P Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PPPP P PP P PP P P PPP P Sbjct: 265 PPPPPAAAP----PPQPPPPPPP----KPQPPPPPKIARPP 297 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP G G P P P+ G P P P P Sbjct: 175 PPPPPVWGPPHGYMAPAPPPYDPYAGYHAPPVPMPTPP 212 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTP-XGPPXPXPPFXGGXPXPXPP 393 PPPP GG P G P PP G P PP Sbjct: 252 PPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPP 286 >At1g70985.1 68414.m08189 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -2 Query: 446 PPXPXPPFXGGXP---XPXPPPXXPXXPXFXXXFFXXXPP 336 P P PP+ GG P PPP P P F F+ PP Sbjct: 67 PNYPSPPYYGGNPSGGYNGPPPPDPILPYF--PFYYRKPP 104 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 460 PXXXPPXRGGGGXFIXKKXPPPPXGXXXXXGXPPPXXXXXKXPXXPGXG 606 P PP GGGG K PPP G PPP P G G Sbjct: 36 PVPKPPQHGGGGGGGSK---PPPHHGGKGGGKPPPHGGKGGGPPHHGGG 81 Score = 29.5 bits (63), Expect = 3.4 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 2/81 (2%) Frame = -2 Query: 626 GGXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXG 447 GG G P P G GGG P P GG G PP GG G Sbjct: 46 GGGGGSKPPPHHGGK------GGGKPP----PHGGKGG-------GPPHHGGGGGGGGKS 88 Query: 446 PPXPXPPFXGGXPXP--XPPP 390 PP PP P P PPP Sbjct: 89 PPVVRPPPVVVRPPPIIRPPP 109 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXP 381 P PP P PP P P PPP P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/73 (26%), Positives = 21/73 (28%) Frame = -2 Query: 512 FFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPX 333 F ++ PP P PP P PP P P PPP PP Sbjct: 27 FLLVQSQDPPLFPQSPPPPPPPPPPPPPP-----PPPPPPPPPAVNMSVETGIPPPPPPV 81 Query: 332 XXFFXXXXGXPPP 294 PPP Sbjct: 82 TDMIKPLSSPPPP 94 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGP--PXPXPPFXGGXPXPXPPPXXPXXP 372 + PPP TP P P P PP P P P P P P Sbjct: 151 VSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXP--XPPPXXP 381 PPPP P PP P P P P PPP P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 PP P TP P P P G P PPP Sbjct: 217 PPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPP 251 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/73 (27%), Positives = 24/73 (32%), Gaps = 6/73 (8%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXP---PP---XXPXXPXFXXXFFXXXPPX 333 PPPP +P PP P P P P PP P P + PP Sbjct: 648 PPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 707 Query: 332 XXFFXXXXGXPPP 294 ++ PPP Sbjct: 708 PVYYLPVTQSPPP 720 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/67 (28%), Positives = 22/67 (32%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP PP P PP P PPP P + PP ++ Sbjct: 607 PPPPTYYATQ-----SPPPPPPPTYYAVQSPPPPP-----PVYYPPVTASPPPPPVYYTP 656 Query: 314 XXGXPPP 294 PPP Sbjct: 657 VIQSPPP 663 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 I PPPP +P PP PP P P PP P Sbjct: 72 IYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPPKVHHP 115 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/71 (29%), Positives = 24/71 (33%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFF 321 + PPPPR PP PP+ G P PPP P + PP Sbjct: 177 RSPPPPRPQAAAYYKKTPPP---PPYKYGRVYPPPPP----PPQAARSYKRSPPPPPPSK 229 Query: 320 XXXXGXPPPXG 288 PPP G Sbjct: 230 YGRVYSPPPPG 240 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -2 Query: 518 GXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP 390 G + + PPPP P PP P P P P PPP Sbjct: 8 GAYSLVPLPPPPPPL-MRRRAPLPPPPPPPLMRRRAPPPPPPP 49 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 PPPP P PP P P P P PPP P Sbjct: 30 PPPPPPPLMRRRAP--PPPPPPLMRRRAPPPPPPPPLP 65 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXPKXXXP 604 PPPP R PPP PP P P Sbjct: 44 PPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = -2 Query: 491 PPPRXGGXXXGTPX----GPPXPXPP-FXGGXPXPXPPP 390 PPPR P G P P PP GG P P PPP Sbjct: 618 PPPRLVCGPYPLPRLVRVGSPSPPPPSMSGGAPPPPPPP 656 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 I PPPP P P P PP P P PP P P Sbjct: 507 IHSPPPPPVYSPPPPPPVYSPPPPPPVYS--PPPPPPVHSPPPP 548 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP PP PP P P PP P P F PP + Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPP 647 Query: 314 XXGXPPP 294 PP Sbjct: 648 PPVYSPP 654 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 500 KXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXP--XPPPXXP 381 + PPPP +P P P P + P P PPP P Sbjct: 491 RSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -2 Query: 503 IKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 + PPPP P P P PP P P PP P P Sbjct: 498 VHSPPPPSPIHSPPPPPVYSPPPPPPVYS--PPPPPPVYSPPPP 539 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = -3 Query: 493 PPPPAXGXXKXGPRXGPPXPXPLFXGVXPXXXPP 392 PPPP P PP P P+ P PP Sbjct: 520 PPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPP 553 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/76 (30%), Positives = 24/76 (31%) Frame = -2 Query: 623 GXXGXXPXPGLXGXFXXXXXGGGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGP 444 G G PG GG G GG F + P P G G GP Sbjct: 16 GFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGP 75 Query: 443 PXPXPPFXGGXPXPXP 396 P P GG P P P Sbjct: 76 RGPRPG-GGGGPGPGP 90 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXP 381 P GPP P PP G P PP P Sbjct: 565 PPGPPAPQPPTQGYPPSNQPPGAYP 589 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXP 381 P GPP P PP G P PP P Sbjct: 565 PPGPPAPQPPTQGYPPSNQPPGAYP 589 >At1g64450.1 68414.m07306 proline-rich family protein contains proline rich extensins, INTERPRO:IPR0002965 Length = 342 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -2 Query: 557 GSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 G+P P G F I P P G P P P PP G P PP P Sbjct: 206 GNPGAPIIPRNPGSPEFPINPPRNP-------GAPVIPRNPNPPVFPGNPRSMGPPGFP 257 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 29.9 bits (64), Expect = 2.6 Identities = 21/77 (27%), Positives = 26/77 (33%), Gaps = 5/77 (6%) Frame = -2 Query: 509 FXIKXPPPPRXGGXXXGTPXGPPX-----PXPPFXGGXPXPXPPPXXPXXPXFXXXFFXX 345 + K PPPP +P PP P PP+ P PPP P + Sbjct: 405 YVYKSPPPPPY---VYSSPPPPPYVYKSPPPPPYV--YSSPPPPPYVYKSPSPPPYVYKS 459 Query: 344 XPPXXXFFXXXXGXPPP 294 PP + PPP Sbjct: 460 PPPPPSYSYSYSSPPPP 476 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 29.5 bits (63), Expect = 3.4 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = -2 Query: 494 PPPPRXGGXXXGT----PXGPP-XPXPPFXGGXPXPXPPPXXPXXP 372 PPPP T P PP PP P P PPP P P Sbjct: 348 PPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPPP 393 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXP 381 P P G G P PP PP P P PPP P Sbjct: 9 PYPAPGNYPQGPP--PPVGVPPQYYPPPPPPPPPPPP 43 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 518 PPPPXGXXRXXGXPPPXPPXXKXP 589 PPPP G PPP PP P Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPPP 43 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = -2 Query: 491 PPPRXGGXXXGTPXGPPX----PXPPFXGGXPXPXPPPXXP 381 PPP+ P PP P PP P P PPP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 29.5 bits (63), Expect = 3.4 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 2/93 (2%) Frame = -2 Query: 560 GGSPXXXXXPXGGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPP--PX 387 GG P P GGG F P G G P GPP P G P P P Sbjct: 126 GGRPSTG--PLVGGGSSFPQPGGFPA--SGPPGGVPSGPPSGARPIGFGSPPPMGPGMSM 181 Query: 386 XPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXG 288 P PP PPP G Sbjct: 182 PPPSGMPGGPLSNGPPPSGMHGGHLSNGPPPSG 214 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 29.5 bits (63), Expect = 3.4 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXP-PFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFX 318 PPPP +P P P P P P PPP P F PP Sbjct: 77 PPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPP-PPEVFEPPPPPADEDE 135 Query: 317 XXXGXPPP 294 PPP Sbjct: 136 SPPAPPPP 143 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFX-GGXPXPXPPP 390 PPPP P P P PP G P P PPP Sbjct: 239 PPPPPSIAVKQSAPT--PSPPPPIKKGSSPSPPPPP 272 >At3g08530.1 68416.m00990 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1703 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -2 Query: 527 GGGGXFFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXG 417 GGGG + PPP+ GG G P PP PP G Sbjct: 1672 GGGGGY-----GPPPQMGGMP-GMPPMPPYGMPPMGG 1702 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXP 381 P PP P PP P PPP P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLP 30 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.1 bits (62), Expect = 4.5 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXX 315 PPPP+ P PP P P P P P F P F Sbjct: 37 PPPPQQHSQPPVAPLVPPGPPYAPPAQIPSSLLPTNLPPPPPFRPGM--QFTPVANFQNP 94 Query: 314 XXGXPPP 294 G PPP Sbjct: 95 SSGVPPP 101 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -2 Query: 455 PXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXF 324 P PP P PP P PPP P P + PP F Sbjct: 61 PPSPPPPSPP----PPACPPPPALPPPPPKKVSSYCPPPPPANF 100 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/87 (27%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = -2 Query: 632 PXGGXXGXXPXPGLXGXFXXXXXG--GGSPXXXXXPXGGGGXFFXIKXPPPPRX-GGXXX 462 P G G P G+ + GG P GG ++ PPPP G Sbjct: 166 PFAGQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGG----MMRGPPPPHGMQGPPP 221 Query: 461 GTPXGPPXPXPPFXGGXPXPXPPPXXP 381 P PP P P P PP P Sbjct: 222 SRPGMPPPGGAPMFA-PPHPGMPPAPP 247 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 28.7 bits (61), Expect = 6.0 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = -2 Query: 488 PPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 PP+ P G P PPF G P P P F PP + Sbjct: 150 PPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQ--YGQRP 207 Query: 308 GXPPPXG 288 PPP G Sbjct: 208 MIPPPGG 214 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 28.7 bits (61), Expect = 6.0 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = -2 Query: 488 PPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXX 309 PP+ P G P PPF G P P P F PP + Sbjct: 150 PPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQ--YGQRP 207 Query: 308 GXPPPXG 288 PPP G Sbjct: 208 MIPPPGG 214 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 458 TPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 TP PP P P F P P PPP P Sbjct: 8 TPPPPPPPPPSFR-SIPRPPPPPSFRSIP 35 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/64 (26%), Positives = 19/64 (29%), Gaps = 1/64 (1%) Frame = -2 Query: 512 FFXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPP-XXPXXPXFXXXFFXXXPP 336 +F P P + PP P PP P P P P P F PP Sbjct: 209 YFKPTKPEPNKPQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPP 268 Query: 335 XXXF 324 F Sbjct: 269 AGGF 272 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -2 Query: 509 FXIKXPPPPRXGGXXXGTPXGPPXPXPPFXGG--XPXPXPPPXXP 381 F ++ PP P PP P P F P P PPP P Sbjct: 34 FPLEETPPVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPP 78 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -2 Query: 488 PPRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXP 372 PP +P PP P PP+ P PPP P P Sbjct: 158 PPPSPDFPPFSPSIPP-PSPPYFPPEPPSIPPPPPPSPP 195 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP---PXPXPPFXGGXPXPXPPPXXP 381 P PP+ TP P P P PP P P PP P Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKP 66 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP---PXPXPPFXGGXPXPXPPPXXP 381 P PP+ TP P P P PP P P PP P Sbjct: 37 PTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKP 77 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP---PXPXPPFXGGXPXPXPPPXXP 381 P PP+ TP P P P PP P P PP P Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKP 88 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGP---PXPXPPFXGGXPXPXPPPXXP 381 P PP+ TP P P P PP P P PP P Sbjct: 70 PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 >At5g07570.1 68418.m00867 glycine/proline-rich protein contains similarity to flagelliform silk protein [Nephila clavipes] gi|7106224|gb|AAF36090 Length = 1504 Score = 28.3 bits (60), Expect = 7.9 Identities = 22/74 (29%), Positives = 25/74 (33%), Gaps = 1/74 (1%) Frame = -1 Query: 612 PXPGSXXXGXFXXGGXGGGXPXXRXXPXGGGGXFFXDKXPPPPPXXGXXXGDP-GWAPXX 436 P G+ G G GG P G F PP G GDP G P Sbjct: 1099 PVAGTSIGGPLDEGASDGGPPDV--------GPFGISPSIIDPPGEGAFDGDPPGKLPLD 1150 Query: 435 LSPFFXGXAXXXPP 394 +SP G + PP Sbjct: 1151 ISPVGKGPSGVSPP 1164 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 28.3 bits (60), Expect = 7.9 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = -2 Query: 527 GGGGXFFXIKXPPP---PRXGGXXXGTPXGPPXPXPPFXGGXPXPXPPPXXPXXPXFXXX 357 GGG P P P P PP P PP P P P P P + Sbjct: 39 GGGSDSTNYNSPAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHY 98 Query: 356 FFXXXPP 336 PP Sbjct: 99 ITPSPPP 105 >At1g51580.1 68414.m05806 KH domain-containing protein Length = 621 Score = 28.3 bits (60), Expect = 7.9 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = -2 Query: 449 GPPXPXPPFXGGXPXPXPPPXXPXXPXFXXXFFXXXPPXXXFFXXXXGXPPPXGGGXXXX 270 G P PPF G P P PP P + P G P G G Sbjct: 445 GMGGPPPPFMGPYPEPPPPFGPRQYPASPDRYHSPVGPFHERHCHGPGFDRPPGPGFDRP 504 Query: 269 P 267 P Sbjct: 505 P 505 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = -2 Query: 494 PPPPRXGGXXXGTPXGPPXP-XPPFXGGXPXPXPP 393 PPPP T PP P PP G P P P Sbjct: 249 PPPPPVVDPPPATHRAPPVPRIPPVSGVPPAPFAP 283 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.310 0.156 0.527 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,917,779 Number of Sequences: 28952 Number of extensions: 311365 Number of successful extensions: 2425 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1478 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2275754832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits)
- SilkBase 1999-2023 -