BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F06 (909 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12B10.07 |acp1||F-actin capping protein alpha subunit|Schizo... 26 8.5 SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosacch... 26 8.5 SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz... 26 8.5 >SPAC12B10.07 |acp1||F-actin capping protein alpha subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 256 Score = 25.8 bits (54), Expect = 8.5 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 809 SHVNRVHYFKTGTYTIDXKKPVN 877 SH+ RVHY++ G +D +P++ Sbjct: 172 SHI-RVHYYEDGNVWLDASRPIS 193 >SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2176 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 400 TWTLDSCELYKLSAWHTYTPLS--PTVTRRIVRR 305 T +LD+C++ + W T +PL P ++RR Sbjct: 1147 TLSLDTCKMIEKRLWPTMSPLRQFPNCPSEVIRR 1180 >SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1273 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 335 SDRHSAYRQTGNTSSTYPYVVS 270 SDR S+Y N +ST P +VS Sbjct: 60 SDRASSYANANNVNSTQPQLVS 81 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,376,566 Number of Sequences: 5004 Number of extensions: 65837 Number of successful extensions: 164 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 460503700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -