BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F06 (909 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g44760.1 68414.m05128 universal stress protein (USP) family p... 29 5.6 At3g53540.1 68416.m05912 expressed protein 28 7.4 >At1g44760.1 68414.m05128 universal stress protein (USP) family protein contains Pfam profile PF00582: universal stress protein family Length = 213 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 316 IVRRETLVPLIHMLSPDAILTPSLDQYTFSGC 221 + + LV L+H++SPD TPSL Q S C Sbjct: 86 LTNKGDLVTLLHVVSPDDEATPSLAQSLGSLC 117 >At3g53540.1 68416.m05912 expressed protein Length = 924 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -3 Query: 274 SPDAILTPSLDQYTFSGCGYPSTSQGRLSSAPAVSVGGADNILVDTGA 131 SP+ +TPSL ++ + G PS S + + S G A++ D+ A Sbjct: 593 SPEVSITPSLSKFVYMNDGIPSKSASPFKARSSFS-GDANSDTEDSSA 639 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,681,360 Number of Sequences: 28952 Number of extensions: 349052 Number of successful extensions: 906 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2149324008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -