BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F04 (880 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32123| Best HMM Match : Keratin_B2 (HMM E-Value=0.019) 29 6.6 SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 >SB_32123| Best HMM Match : Keratin_B2 (HMM E-Value=0.019) Length = 1097 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 570 LSTFYFRARHWSRIIHTIWNRCVHL*YVSRDLSCRVLH 457 + T ++ RH +I T+ R H +V + LSCR H Sbjct: 977 MQTSSYKRRHTDLVIQTLSYRPCHTDFVMQTLSCRPRH 1014 >SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 319 STRTRPSLSSHRNNAKGAAKTPTTTEK 399 ST T S +S R +A+G AKT TT+K Sbjct: 233 STITTSSRASSRGSARGGAKTTKTTKK 259 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,257,125 Number of Sequences: 59808 Number of extensions: 458462 Number of successful extensions: 1030 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2502612210 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -