BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_F03 (898 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 25 3.1 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 7.2 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 9.5 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 25.0 bits (52), Expect = 3.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 876 SHERCGSERA*NVKGNVSPWGRR 808 SH R G+ER+ G+ SP G+R Sbjct: 384 SHRRTGTERSFLYNGSQSPTGQR 406 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.8 bits (49), Expect = 7.2 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +2 Query: 458 SKCPRFAWSTAHAVFXCYLRRASRH--LHDPVSSKTTHSTMPSPK 586 ++CP A S HA+F C ++R LH V + SP+ Sbjct: 1017 TRCPGVAESAEHAMFECPRFDSTRTELLHGVVPETLLEHMLQSPE 1061 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.4 bits (48), Expect = 9.5 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 194 SEVYSTSEPPPAYRHRVS 247 +++YST EP A+ R+S Sbjct: 427 TDIYSTREPQLAFHQRIS 444 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 882,043 Number of Sequences: 2352 Number of extensions: 17661 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96747534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -