Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_E22
         (883 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0418 - 3186093-3186437,3187286-3187438,3187541-3188398,318...    29   6.5  

>07_01_0418 -
           3186093-3186437,3187286-3187438,3187541-3188398,
           3188479-3188541
          Length = 472

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 4/71 (5%)
 Frame = +3

Query: 258 HARLLHANGFFSLDNETFVPAYRLSEHCSAVNVKTN---LFEMP-VKLARPLNRFAKLDS 425
           H RL+H +GF  + ++  +  + L        +K +   LF +P + +  PL  F  LD 
Sbjct: 362 HLRLVHISGFIGMKDQLELSLHILRNSAMIRAMKVDPKPLFALPCISMLSPLEGFQYLDG 421

Query: 426 LQKICRFVIRQ 458
            +    ++ R+
Sbjct: 422 YEVAIEYLCRE 432


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,310,491
Number of Sequences: 37544
Number of extensions: 408337
Number of successful extensions: 891
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 864
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 891
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2491484208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)