BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_E22 (883 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 3.1 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 9.3 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.0 bits (52), Expect = 3.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 120 WYWGGITSSEAEELLAGQHDNVFLVRDS 203 WY I+ EA LL F+VRDS Sbjct: 1219 WYKPNISREEAIALLRNAAPGTFIVRDS 1246 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 9.3 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 417 LDSLQKICRFVIRQTGSSNTWAKLPLPPNL 506 L S ++ F+++ ++ +LP PPNL Sbjct: 3032 LFSTEQFSDFIVKPLSKASPKLRLPKPPNL 3061 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 875,239 Number of Sequences: 2352 Number of extensions: 18503 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94680279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -