BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_E18 (950 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.18 |rpl6||60S ribosomal protein L6|Schizosaccharomyces p... 73 6e-14 SPBC725.17c |rrn11||RNA polymerase I transcription factor subuni... 31 0.24 SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe... 26 9.0 >SPCC622.18 |rpl6||60S ribosomal protein L6|Schizosaccharomyces pombe|chr 3|||Manual Length = 195 Score = 72.9 bits (171), Expect = 6e-14 Identities = 47/107 (43%), Positives = 63/107 (58%), Gaps = 5/107 (4%) Frame = +3 Query: 333 QIGGEKNGGTRTV-PL-KRRKSFYPT-QEKI--RASSGGRPFSKHVRRIRPNLKIGTVCI 497 ++ G KNGG R V P + +YP +E + +A RP ++R +L GTVCI Sbjct: 5 KVNGAKNGGERMVLPAGEAAAKYYPAYRENVPKKARKAVRP-----TKLRASLAPGTVCI 59 Query: 498 LLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVICTS 638 LLAGR GKRVV++ L L+VTGP+ N P+RR+ RYVI TS Sbjct: 60 LLAGRFRGKRVVVLSQL-EDTLVVTGPYKVNGVPIRRVNHRYVIATS 105 >SPBC725.17c |rrn11||RNA polymerase I transcription factor subunit Rrn11 |Schizosaccharomyces pombe|chr 2|||Manual Length = 200 Score = 31.1 bits (67), Expect = 0.24 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -2 Query: 541 PTSTTLLPACLPARRMQTVPIFRLGRILRTCLLNGRPPDEARIFS 407 P S+ + P LP+RR +T I L ++ CLL P +R FS Sbjct: 21 PESSVIPPIPLPSRRYKTRHIDALCSLMHLCLLRKDYPRASRAFS 65 >SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 687 Score = 25.8 bits (54), Expect = 9.0 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = +1 Query: 370 YPSNVGSPST-----PLRRKSVPHLVAVHSASMY 456 Y SNV SPS P R ++ L+ VHS MY Sbjct: 96 YVSNVPSPSDVFLRIPAREATLEELLQVHSQEMY 129 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,239,628 Number of Sequences: 5004 Number of extensions: 62074 Number of successful extensions: 207 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 206 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 485316198 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -