BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_E15 (884 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1239 - 27275110-27275445 31 1.6 02_05_0595 - 30225747-30226589,30227248-30227386,30228734-30228849 28 8.7 >12_02_1239 - 27275110-27275445 Length = 111 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 682 RTIXIPGVSPWKA-PSCAPXVPDPAVYRIPVR 774 R + P PW+A PS AP P VYR+ R Sbjct: 18 RAVQKPPAKPWRASPSAAPGPAPPKVYRVEPR 49 >02_05_0595 - 30225747-30226589,30227248-30227386,30228734-30228849 Length = 365 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 694 IPGVSPWKAPSCAPXVPDPAVY 759 +P + W A SC VPDP VY Sbjct: 342 VPPAAYWNAGSCWTDVPDPNVY 363 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,064,399 Number of Sequences: 37544 Number of extensions: 281917 Number of successful extensions: 656 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2503236492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -