BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_E14 (868 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.08c |||nuclear telomere cap complex subunit |Schizosacc... 29 0.86 SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc... 27 2.6 >SPBC16A3.08c |||nuclear telomere cap complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 284 Score = 29.1 bits (62), Expect = 0.86 Identities = 20/64 (31%), Positives = 27/64 (42%) Frame = -1 Query: 823 PDKAQRSG*TGVRAHSPAWSERPTPN*DTYSVSYEKXATLPEGRKADSIR*AAGSEQESA 644 PD A+ G T A +PA E D Y +S K A P GR + + A E+ + Sbjct: 151 PDVAENEGNTPSGAQTPAAEEENVKTLDEY-LSERKSAAKPVGRTVEKLENATKVEKSAP 209 Query: 643 RGSF 632 F Sbjct: 210 EELF 213 >SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 934 Score = 27.5 bits (58), Expect = 2.6 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 547 LNEHHKNRRSSQRWRNPTGL*RYQAF----PPGSSLVRSPVPTLPLTGY 681 L ++HKNR+S+ P GL Y+A PPG + L GY Sbjct: 387 LQDYHKNRKSNFNKPGPDGLGLYKAVLLSGPPGIGKTTAAHLVAKLEGY 435 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,163,468 Number of Sequences: 5004 Number of extensions: 61501 Number of successful extensions: 153 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 432473040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -