BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_E14 (868 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 151 7e-37 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 126 2e-29 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 124 9e-29 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 123 2e-28 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 3e-28 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 4e-28 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 4e-28 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 122 4e-28 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 111 5e-25 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 6e-23 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 4e-22 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 98 9e-21 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 9e-21 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 9e-21 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 4e-19 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 87 2e-17 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 54 1e-07 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 49 6e-06 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 48 1e-05 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 46 4e-05 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 46 4e-05 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 46 5e-05 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 45 9e-05 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 45 9e-05 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 45 9e-05 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 45 9e-05 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 45 9e-05 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 45 9e-05 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 45 9e-05 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 45 9e-05 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 45 9e-05 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 45 9e-05 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 45 9e-05 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 45 9e-05 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 45 9e-05 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 45 9e-05 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 45 9e-05 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 45 9e-05 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 45 9e-05 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 45 9e-05 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 45 9e-05 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 45 9e-05 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 45 9e-05 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 45 9e-05 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 45 9e-05 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 45 9e-05 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 45 9e-05 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 45 9e-05 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 45 9e-05 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 45 9e-05 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 45 9e-05 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 45 9e-05 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 45 9e-05 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 45 9e-05 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 45 9e-05 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 45 9e-05 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 45 9e-05 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 45 9e-05 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 45 9e-05 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 45 9e-05 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 45 9e-05 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 45 9e-05 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 45 9e-05 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 45 9e-05 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 45 9e-05 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 45 9e-05 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 45 9e-05 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 45 9e-05 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 45 9e-05 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 45 9e-05 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 45 9e-05 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 45 9e-05 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 9e-05 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 45 9e-05 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 45 9e-05 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 45 9e-05 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 45 9e-05 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 45 9e-05 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 45 9e-05 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 45 9e-05 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 45 9e-05 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 45 9e-05 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 45 9e-05 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 45 9e-05 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 45 9e-05 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 45 9e-05 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 45 9e-05 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 45 9e-05 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 45 9e-05 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 45 9e-05 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 9e-05 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 45 9e-05 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 45 9e-05 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 45 9e-05 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 45 9e-05 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 45 9e-05 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 45 9e-05 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 45 9e-05 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 45 9e-05 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 9e-05 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 45 9e-05 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 45 9e-05 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 45 9e-05 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 45 9e-05 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 45 9e-05 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 9e-05 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 45 9e-05 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 45 9e-05 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 45 9e-05 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 45 9e-05 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 45 9e-05 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_13233| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_12576| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_12547| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_12526| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 151 bits (366), Expect = 7e-37 Identities = 77/111 (69%), Positives = 81/111 (72%) Frame = +2 Query: 461 KEHVSKRPAKGQEP*KSRVAGVFXXXXXXXTSITKIDAQVRGGETRQDYKDTRRFPLEAP 640 ++ SKRP + P R F TSITKIDAQVRGGETRQDYKDTRRFPLEAP Sbjct: 96 EQKASKRPGTVKRPRCWR----FSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAP 151 Query: 641 SCALLFRPCRLPDTVRLSPFGKRGXFLIAHAVGISVRCRSFAPSWAVCTNP 793 SCALLFRPCRLPDT + FLIAHAVGISVRCRSFAPSWAVCTNP Sbjct: 152 SCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNP 202 Score = 115 bits (277), Expect = 4e-26 Identities = 72/136 (52%), Positives = 83/136 (61%), Gaps = 9/136 (6%) Frame = +1 Query: 442 NQGITQERTCEQKASKRPGTVKKPRCWRFSIGSAPLNEHHK---NRRSSQRWRNPTGL*R 612 NQGITQERTCEQKASKRPGTVK+PRCWRFSIGSAPL K R + ++ R Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 145 Query: 613 YQAFPPGSSLVRSPVPTLPLTGYCPPFSLREAW--XLSH----SSRCRYLSSV*VVRSKL 774 + P +L+ P LP T CPPFSLREAW ++H S RCR + V Sbjct: 146 FPLEAPSCALLFRPC-RLPDT--CPPFSLREAWRFLIAHAVGISVRCRSFAPSWAV---- 198 Query: 775 GCVHEPPFSPTAAPYP 822 C + PPFSPTAAPYP Sbjct: 199 -CTN-PPFSPTAAPYP 212 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 126 bits (304), Expect = 2e-29 Identities = 57/63 (90%), Positives = 60/63 (95%) Frame = -2 Query: 567 IFVMLVQGGGAYGKTPATRLFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAA 388 +FV+ +GGGAYGKTPATR FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAA Sbjct: 548 LFVLRGKGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAA 607 Query: 387 ERP 379 ERP Sbjct: 608 ERP 610 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 124 bits (299), Expect = 9e-29 Identities = 56/57 (98%), Positives = 56/57 (98%) Frame = -2 Query: 549 QGGGAYGKTPATRLFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 379 QGGGAYGKTPATR FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 22 QGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 78 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 123 bits (296), Expect = 2e-28 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 549 QGGGAYGKTPATRLFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 379 +GGGAYGKTPATR FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 461 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 122 bits (295), Expect = 3e-28 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 549 QGGGAYGKTPATRLFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 379 +GGGAYGKTPATR FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 758 RGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 814 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 122 bits (294), Expect = 4e-28 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -2 Query: 546 GGGAYGKTPATRLFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 379 GGGAYGKTPATR FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 122 bits (294), Expect = 4e-28 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -2 Query: 546 GGGAYGKTPATRLFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 379 GGGAYGKTPATR FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 79 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 122 bits (294), Expect = 4e-28 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -2 Query: 546 GGGAYGKTPATRLFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 379 GGGAYGKTPATR FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 111 bits (268), Expect = 5e-25 Identities = 62/111 (55%), Positives = 69/111 (62%) Frame = +2 Query: 461 KEHVSKRPAKGQEP*KSRVAGVFXXXXXXXTSITKIDAQVRGGETRQDYKDTRRFPLEAP 640 ++ SKRP + P R F TSITKIDAQVRGGETRQDYKDTRRFPLEAP Sbjct: 125 EQKASKRPGTVKRPRCWR----FSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAP 180 Query: 641 SCALLFRPCRLPDTVRLSPFGKRGXFLIAHAVGISVRCRSFAPSWAVCTNP 793 SCALLFRPCRLPDT + FLIAHAV I ++F S + P Sbjct: 181 SCALLFRPCRLPDTCPPFSLREAWRFLIAHAVAIRTAKKTFQGSTSSMAAP 231 Score = 99.1 bits (236), Expect = 4e-21 Identities = 54/94 (57%), Positives = 62/94 (65%), Gaps = 3/94 (3%) Frame = +1 Query: 439 QNQGITQERTCEQKASKRPGTVKKPRCWRFSIGSAPLNEHHK---NRRSSQRWRNPTGL* 609 +NQGITQERTCEQKASKRPGTVK+PRCWRFSIGSAPL K R + ++ Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTR 173 Query: 610 RYQAFPPGSSLVRSPVPTLPLTGYCPPFSLREAW 711 R+ P +L+ P LP T CPPFSLREAW Sbjct: 174 RFPLEAPSCALLFRPC-RLPDT--CPPFSLREAW 204 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 105 bits (251), Expect = 6e-23 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = -1 Query: 559 DARSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 D SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 55 DLNSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 102 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 103 bits (246), Expect = 2e-22 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 102 bits (244), Expect = 4e-22 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -1 Query: 553 RSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 ++GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 91 QAGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 136 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 97.9 bits (233), Expect = 9e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +1 Query: 292 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 423 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 97.9 bits (233), Expect = 9e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 544 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 GRSLWKNASNAAFLRFLAFCWPFAHMF+PALSPDSVDNRITAF Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAF 44 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 97.9 bits (233), Expect = 9e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +1 Query: 292 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 423 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 92.7 bits (220), Expect = 4e-19 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = -1 Query: 550 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 SGGRSLWKNASNAAFLRFLAF WPFAHMFF ALSPD VDNRITAF Sbjct: 16 SGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAF 60 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 87.4 bits (207), Expect = 1e-17 Identities = 39/43 (90%), Positives = 39/43 (90%) Frame = -1 Query: 544 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 G KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF Sbjct: 18 GAEPMKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 86.6 bits (205), Expect = 2e-17 Identities = 39/43 (90%), Positives = 39/43 (90%) Frame = -1 Query: 544 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF 416 GRSLWKNASNAAFLRFLAFCWPF HMF PALSPDSVD ITAF Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAF 44 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 77.0 bits (181), Expect = 2e-14 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +2 Query: 551 TSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTVR 688 TSITK DAQ+ GGETRQDYKDTRRFPL APSCALLF P LP + R Sbjct: 121 TSITKSDAQISGGETRQDYKDTRRFPLAAPSCALLFLPFGLPVSFR 166 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 64.5 bits (150), Expect = 1e-10 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = -1 Query: 658 EQESARGSFQGETPGIFIVLSGFATSDLSVDFCDARSGGRSLWKNA 521 EQESARGS QGET GIFIVLSGFAT+DLSV F DA GG + K A Sbjct: 10 EQESARGSRQGETLGIFIVLSGFATTDLSVRFRDACQGGGAYGKTA 55 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 54.4 bits (125), Expect = 1e-07 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = +2 Query: 551 TSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLPDTVR 688 TSITK DAQ+ GGETRQDYKDTRR C +L P P + R Sbjct: 159 TSITKSDAQISGGETRQDYKDTRRLHQAGTLCGVLILPFGFPVSFR 204 Score = 49.2 bits (112), Expect = 4e-06 Identities = 37/80 (46%), Positives = 42/80 (52%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLTQRR*YGYPQNQGITQERTCEQKASKRPGTVK 507 +C G +PLPRSLTR ARSF CGER LT G E +K R V+ Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT--------NGGGDFLEDA--RKILNR--EVR 144 Query: 508 KPRCWRFSIGSAPLNEHHKN 567 PR RFSIGSAPL K+ Sbjct: 145 GPRQSRFSIGSAPLTSITKS 164 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 49.2 bits (112), Expect = 4e-06 Identities = 27/51 (52%), Positives = 27/51 (52%) Frame = +3 Query: 318 GRGGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 G GGLRIG HSKAVIRLSTESGDNAGKNM Sbjct: 51 GPGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/55 (49%), Positives = 28/55 (50%) Frame = +3 Query: 306 GQRAGRGGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 G G GGLRIG HSKAVIRLSTESGDNAGKN+ Sbjct: 30 GTYTGGGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 84 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/50 (52%), Positives = 27/50 (54%) Frame = +3 Query: 321 RGGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 RGGLRIG HSKAVIRLSTESGDNAGKN+ Sbjct: 262 RGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 311 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/49 (53%), Positives = 26/49 (53%) Frame = +3 Query: 324 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 GGLRIG HSKAVIRLSTESGDNAGKNM Sbjct: 575 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 623 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/49 (53%), Positives = 26/49 (53%) Frame = +3 Query: 324 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 GGLRIG HSKAVIRLSTESGDNAGKNM Sbjct: 7 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 55 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/49 (53%), Positives = 26/49 (53%) Frame = +3 Query: 324 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 GGLRIG HSKAVIRLSTESGDNAGKNM Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 50 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/49 (53%), Positives = 26/49 (53%) Frame = +3 Query: 324 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 GGLRIG HSKAVIRLSTESGDNAGKNM Sbjct: 140 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 188 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLTQR 420 +C G +PLPRSLTR ARSF CGER LT R Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNR 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/49 (51%), Positives = 26/49 (53%) Frame = +3 Query: 324 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 GGLRIG HSKAVIRLSTESGDNAGKN+ Sbjct: 448 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 496 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/49 (51%), Positives = 26/49 (53%) Frame = +3 Query: 324 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 GGLRIG HSKAVIRLSTESGDNAGKN+ Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAESAHSKAVIRLSTESGDNAGKNI 50 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/49 (51%), Positives = 26/49 (53%) Frame = +3 Query: 324 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 GGLRIG HSKAVIRLSTESGDNAGKN+ Sbjct: 309 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 357 >SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.0 bits (104), Expect = 4e-05 Identities = 25/49 (51%), Positives = 26/49 (53%) Frame = +3 Query: 324 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 470 GGLRIG HSKAVIRLSTESGDNAGKN+ Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 50 >SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) Length = 302 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = +3 Query: 324 GGLRIGXXXXXXXXXXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKN 467 GGLRIG HSKAVIRLSTESGDNAGKN Sbjct: 254 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 301 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 45.2 bits (102), Expect = 7e-05 Identities = 39/110 (35%), Positives = 50/110 (45%), Gaps = 6/110 (5%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLTQRR*YGYPQNQGITQERTCEQKASKRPGTVK 507 +C G +PLPRSLTR ARSF CGER LT + + +RP Sbjct: 197 ICDTGYIPLPRSLTRYARSFDCGERKWLTNGAEISWKMPGRYLTGNPGDPLVLERP---- 252 Query: 508 KPRCWRFSIGSAPLNEHHKNRRS--SQR--WRNP--TGL*RYQAFPPGSS 639 P W ++P +E + N + QR W NP T L R A PP +S Sbjct: 253 -PPRWS---SNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 298 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = +2 Query: 263 FRVEVWEVFSALMNRPTRGERRFAYW 340 FRV V +ALMNRPTRGERRFAYW Sbjct: 136 FRVGKPVVPAALMNRPTRGERRFAYW 161 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWLT 200 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWLT 324 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWLT 174 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWLT 131 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWLT 279 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = +2 Query: 257 FRFRVEVWEVFSALMNRPTRGERRFAYW 340 ++ RV V +ALMNRPTRGERRFAYW Sbjct: 29 YKERVGKPVVPAALMNRPTRGERRFAYW 56 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWLT 421 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWLT 276 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWLT 176 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWLT 639 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWLT 395 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWLT 238 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWLT 196 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWLT 207 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWLT 165 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWLT 91 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWLT 628 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = +2 Query: 263 FRVEVWEVFSALMNRPTRGERRFAYW 340 +RV V +ALMNRPTRGERRFAYW Sbjct: 110 YRVGKPVVPAALMNRPTRGERRFAYW 135 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWLT 124 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWLT 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWLT 167 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWLT 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWLT 127 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWLT 265 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWLT 656 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWLT 378 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWLT 882 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWLT 267 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 187 AALMNRPTRGERRFAYW 203 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWLT 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWLT 567 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWLT 112 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1012 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWLT 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWLT 517 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +2 Query: 254 CFRFRVEVWEVFSALMNRPTRGERRFAYW 340 C R V V +ALMNRPTRGERRFAYW Sbjct: 58 CVRVTVGKPVVPAALMNRPTRGERRFAYW 86 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWLT 313 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWLT 132 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWLT 222 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWLT 307 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 227 AALMNRPTRGERRFAYW 243 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWLT 183 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGERKWLT 153 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNR TRGERRFA W Sbjct: 73 AALMNRATRGERRFADW 89 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1023 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 943 AALMNRPTRGERRFAYW 959 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWLT 170 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 90 AALMNRPTRGERRFAYW 106 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWLT 503 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 423 AALMNRPTRGERRFAYW 439 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWLT 185 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 105 AALMNRPTRGERRFAYW 121 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWLT 551 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 471 AALMNRPTRGERRFAYW 487 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWLT 549 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 469 AALMNRPTRGERRFAYW 485 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWLT 171 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 91 AALMNRPTRGERRFAYW 107 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWLT 173 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 93 AALMNRPTRGERRFAYW 109 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/35 (60%), Positives = 25/35 (71%) Frame = +2 Query: 236 TIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 T+ +LC+ V V +ALMNRPTRGERRFAYW Sbjct: 85 TVGPLLCY---VGKPVVPAALMNRPTRGERRFAYW 116 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWLT 319 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 239 AALMNRPTRGERRFAYW 255 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1234 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 1154 AALMNRPTRGERRFAYW 1170 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGERKWLT 135 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 55 AALMNRPTRGERRFAYW 71 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGERKWLT 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 48 AALMNRPTRGERRFAYW 64 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGERKWLT 126 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 46 AALMNRPTRGERRFAYW 62 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1476 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1504 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 1424 AALMNRPTRGERRFAYW 1440 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 629 ICDTGYIPLPRSLTRYARSFDCGERKWLT 657 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 577 AALMNRPTRGERRFAYW 593 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWLT 117 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 326 ICDTGYIPLPRSLTRYARSFDCGERKWLT 354 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 274 AALMNRPTRGERRFAYW 290 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWLT 202 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = +2 Query: 263 FRVEVWEVFSALMNRPTRGERRFAYW 340 F+V V +ALMNRPTRGERRFAYW Sbjct: 113 FQVGKPVVPAALMNRPTRGERRFAYW 138 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWLT 566 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 486 AALMNRPTRGERRFAYW 502 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 160 ICDTGYIPLPRSLTRYARSFDCGERKWLT 188 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 182 ICDTGYIPLPRSLTRYARSFDCGERKWLT 210 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 130 AALMNRPTRGERRFAYW 146 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 154 ICDTGYIPLPRSLTRYARSFDCGERKWLT 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 102 AALMNRPTRGERRFAYW 118 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 119 ICDTGYIPLPRSLTRYARSFDCGERKWLT 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 67 AALMNRPTRGERRFAYW 83 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 115 ICDTGYIPLPRSLTRYARSFDCGERKWLT 143 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 545 ICDTGYIPLPRSLTRYARSFDCGERKWLT 573 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 493 AALMNRPTRGERRFAYW 509 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 440 ICDTGYIPLPRSLTRYARSFDCGERKWLT 468 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 388 AALMNRPTRGERRFAYW 404 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 227 ICDTGYIPLPRSLTRYARSFDCGERKWLT 255 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 175 AALMNRPTRGERRFAYW 191 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 95 ICDTGYIPLPRSLTRYARSFDCGERKWLT 123 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 43 AALMNRPTRGERRFAYW 59 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 637 ICDTGYIPLPRSLTRYARSFDCGERKWLT 665 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 585 AALMNRPTRGERRFAYW 601 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRVEVWEVFSALMNRPTRGERRFAYW 340 +++LT L RF V V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +1 Query: 328 VCVLGALPLPRSLTRCARSFGCGERYQLT 414 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYW 340 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,964,186 Number of Sequences: 59808 Number of extensions: 523865 Number of successful extensions: 3215 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2973 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2479240863 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -