BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_E14 (868 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-4641|AAN14249.1| 659|Drosophila melanogaster CG31019-P... 30 3.6 U31961-5|AAA84404.1| 424|Drosophila melanogaster protein ( Dros... 29 8.3 AE014297-2268|AAF55361.3| 417|Drosophila melanogaster CG10349-P... 29 8.3 >AE014297-4641|AAN14249.1| 659|Drosophila melanogaster CG31019-PA protein. Length = 659 Score = 30.3 bits (65), Expect = 3.6 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 9/76 (11%) Frame = -2 Query: 681 VSGKRQGRNRRAHEGASRGKRLVSL----*SCRVSPPLT*ASIFVMLVQGGGA-----YG 529 V KR+GRNR AH SR K + + R P+ ++ + GGG G Sbjct: 492 VRSKRRGRNRHAHHSRSRSKTRYEVKPRPKTPRCHAPIAYTNLSICYDSGGGGGSSDEGG 551 Query: 528 KTPATRLFYGSWPFAG 481 +PA L GS F+G Sbjct: 552 FSPARPLAPGSSCFSG 567 >U31961-5|AAA84404.1| 424|Drosophila melanogaster protein ( Drosophila melanogasterbithorax complex (BX-C), complete sequence. ). Length = 424 Score = 29.1 bits (62), Expect = 8.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 301 ESANARGEAVCVLGALPLPRSLTRCARSFGCG 396 ES +VC G LP+P L C + GCG Sbjct: 340 ESYQTTSASVCHSGWLPVPGHLAGCGQRRGCG 371 >AE014297-2268|AAF55361.3| 417|Drosophila melanogaster CG10349-PA protein. Length = 417 Score = 29.1 bits (62), Expect = 8.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 301 ESANARGEAVCVLGALPLPRSLTRCARSFGCG 396 ES +VC G LP+P L C + GCG Sbjct: 333 ESYQTTSASVCHSGWLPVPGHLAGCGQRRGCG 364 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,324,880 Number of Sequences: 53049 Number of extensions: 768864 Number of successful extensions: 1865 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1865 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4188579408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -