BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_E13 (938 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|ch... 66 5e-12 SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha 2|Schizosacchar... 66 9e-12 SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|... 41 3e-04 SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces... 27 3.8 >SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|chr 2|||Manual Length = 455 Score = 66.5 bits (155), Expect = 5e-12 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 184 HVGQAGVQIGNACWELYCLEHGIQPDGQMPTDKN 285 HVGQAGVQIGNACWELYCLEHGI PDG PT+ + Sbjct: 8 HVGQAGVQIGNACWELYCLEHGIGPDG-FPTENS 40 >SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 449 Score = 65.7 bits (153), Expect = 9e-12 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 184 HVGQAGVQIGNACWELYCLEHGIQPDGQM 270 HVGQAG QIGNACWELYCLEHGIQP+G M Sbjct: 8 HVGQAGTQIGNACWELYCLEHGIQPNGYM 36 >SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr 2|||Manual Length = 446 Score = 40.7 bits (91), Expect = 3e-04 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 190 GQAGVQIGNACWELYCLEHGIQPDGQM 270 GQ G QIG+ W+ CLEHGI PDG + Sbjct: 11 GQCGNQIGSQFWQQLCLEHGIGPDGTL 37 >SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces pombe|chr 2|||Manual Length = 448 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 190 GQAGVQIGNACWELYCLEHGIQPDG 264 GQ G Q+G A W EHG+ G Sbjct: 10 GQCGNQVGAAFWSTIADEHGLDSAG 34 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,127,263 Number of Sequences: 5004 Number of extensions: 17091 Number of successful extensions: 44 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 477327454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -