BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_E10 (930 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0013 + 24852262-24852264,24852717-24852900,24853449-24853471 89 5e-18 11_04_0100 + 13465369-13465371,13465464-13465647,13466506-13466528 87 1e-17 07_03_0802 - 21614891-21615195,21615637-21615823,21615939-216161... 87 1e-17 >05_06_0013 + 24852262-24852264,24852717-24852900,24853449-24853471 Length = 69 Score = 89.0 bits (211), Expect = 5e-18 Identities = 42/61 (68%), Positives = 51/61 (83%) Frame = +3 Query: 132 KTF*LKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSLPPGLQVKE 311 K F L ARRKDA+SV+IK++ + VKFKVRCSR+LYTL + D +KA KLKQSLPPGL V+E Sbjct: 9 KDFLLTARRKDARSVRIKRSKDAVKFKVRCSRYLYTLCVHDTDKANKLKQSLPPGLTVQE 68 Query: 312 V 314 V Sbjct: 69 V 69 >11_04_0100 + 13465369-13465371,13465464-13465647,13466506-13466528 Length = 69 Score = 87.4 bits (207), Expect = 1e-17 Identities = 41/61 (67%), Positives = 50/61 (81%) Frame = +3 Query: 132 KTF*LKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSLPPGLQVKE 311 K F L ARRKDA+SV+IK+ + VKFKVRCS++LYTL + D +KA KLKQSLPPGL V+E Sbjct: 9 KDFLLTARRKDARSVRIKRTKDAVKFKVRCSKYLYTLCVFDADKANKLKQSLPPGLTVQE 68 Query: 312 V 314 V Sbjct: 69 V 69 >07_03_0802 - 21614891-21615195,21615637-21615823,21615939-21616154, 21616669-21616872,21617336-21617569,21617670-21617763, 21618844-21618890,21619293-21619309,21620183-21620459 Length = 526 Score = 87.4 bits (207), Expect = 1e-17 Identities = 41/61 (67%), Positives = 50/61 (81%) Frame = +3 Query: 132 KTF*LKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSLPPGLQVKE 311 K F L ARRKDA+SV+IK+ + VKFKVRCS++LYTL + D +KA KLKQSLPPGL V+E Sbjct: 39 KDFLLTARRKDARSVRIKRTKDAVKFKVRCSKYLYTLCVFDADKANKLKQSLPPGLTVQE 98 Query: 312 V 314 V Sbjct: 99 V 99 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,040,408 Number of Sequences: 37544 Number of extensions: 141201 Number of successful extensions: 280 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 280 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2659245980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -