SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_E07
         (878 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292379-1|CAL23191.2|  376|Tribolium castaneum gustatory recept...    23   2.4  
AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esteras...    23   4.2  
AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esteras...    23   4.2  
AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory recept...    21   9.7  

>AM292379-1|CAL23191.2|  376|Tribolium castaneum gustatory receptor
           candidate 58 protein.
          Length = 376

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 10/38 (26%), Positives = 18/38 (47%)
 Frame = -3

Query: 363 SITNFTNKAFFSLHSSCGLSXLINVSYHVWIXLTLNKG 250
           S+ NFT   FF +  S     L   + ++ + +  N+G
Sbjct: 336 SVANFTAAGFFDVKRSTLFGILATTTTYLIVTIQFNQG 373


>AJ850291-1|CAH64511.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 354 NFTNKAFFSLH 322
           NF NKAFF  H
Sbjct: 20  NFNNKAFFCFH 30


>AJ850290-1|CAH64510.1|  533|Tribolium castaneum putative esterase
           protein.
          Length = 533

 Score = 22.6 bits (46), Expect = 4.2
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 354 NFTNKAFFSLH 322
           NF NKAFF  H
Sbjct: 20  NFNNKAFFCFH 30


>AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory receptor
           candidate 57 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +2

Query: 74  FDNIRE*LNCHVDG 115
           FDNI + L C +DG
Sbjct: 182 FDNIMKNLICEIDG 195


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,948
Number of Sequences: 336
Number of extensions: 2491
Number of successful extensions: 10
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24306755
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -