BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D24 (907 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1029| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_53563| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 29 3.9 SB_54685| Best HMM Match : RFX_DNA_binding (HMM E-Value=1.2e-08) 28 9.0 >SB_1029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 558 ILSSITQVLALINNYFWLLLLILPIRVFWLLWTNILG 668 +L + VLALIN L L ++P +V W +W +LG Sbjct: 467 LLGRLALVLALINICLGLFLAVVP-QVAWTVWYAVLG 502 >SB_53563| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 168 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 700 CFQELLGKXQGPSILVHNSQNTLIGKIRSNSQ 605 C QELL P IL +N + GK++ NSQ Sbjct: 85 CDQELLEVSYEPDILSEGEENQVKGKLKRNSQ 116 >SB_54685| Best HMM Match : RFX_DNA_binding (HMM E-Value=1.2e-08) Length = 510 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +3 Query: 498 DPGLDLNMEGGMGEHIKDIVILSSITQVLALINNYFWLLLL 620 D + N +GGM H+K ++ S + V+A+ ++ + +L+ Sbjct: 228 DTVISANFDGGMPIHMKSVLQCSVLVDVIAICDSILYKVLI 268 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,916,891 Number of Sequences: 59808 Number of extensions: 450531 Number of successful extensions: 745 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -