BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D23 (937 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0082 - 40965947-40967023 44 2e-04 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 44 2e-04 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 43 4e-04 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 41 0.002 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 40 0.003 02_05_0686 - 30900748-30902167,30903442-30904742 39 0.005 07_01_0479 + 3606663-3607448 38 0.015 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 37 0.020 07_03_1136 + 24218601-24218734,24218769-24219906 37 0.026 08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526... 36 0.046 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 35 0.11 04_04_1049 + 30414545-30414596,30414732-30414853,30415121-304151... 34 0.14 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 34 0.19 07_01_0080 + 587674-588510 34 0.19 12_02_0848 + 23636478-23638058 33 0.25 12_02_0299 - 17051570-17052474,17053542-17053755 33 0.25 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 33 0.25 07_03_0600 + 19866757-19867218,19867920-19868429 33 0.25 03_01_0515 - 3864796-3865425 33 0.25 11_06_0184 - 21006659-21009823 33 0.33 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 33 0.33 03_05_0067 - 20460206-20460703,20461255-20461530 33 0.33 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 33 0.43 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 33 0.43 01_03_0005 + 11568545-11569119,11569179-11569191 33 0.43 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 32 0.57 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 32 0.57 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 32 0.75 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 31 1.00 07_01_0516 - 3850252-3852870 31 1.00 06_01_1050 + 8262033-8262165,8262262-8262391,8262486-8263026 31 1.00 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 31 1.00 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 31 1.00 02_05_0742 + 31415862-31417088 25 1.3 07_03_1713 + 28939446-28939574,28939674-28940231,28940338-289404... 31 1.3 06_01_1013 - 7931756-7935109 31 1.3 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 31 1.3 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 31 1.3 11_01_0359 - 2731522-2732346 31 1.7 09_06_0172 + 21329904-21331512,21331595-21331740,21332333-213325... 31 1.7 09_06_0125 - 21011757-21012428 31 1.7 07_03_0890 - 22332768-22333382 31 1.7 05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 31 1.7 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 31 1.7 02_04_0400 - 22608519-22608844,22609044-22609122 31 1.7 02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787,643... 31 1.7 01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 31 1.7 01_01_0715 - 5542648-5543219,5543352-5543544 31 1.7 12_02_1174 - 26696869-26698191 30 2.3 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 30 2.3 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 30 2.3 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 30 2.3 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 30 2.3 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 30 2.3 03_05_1081 + 30235677-30236474 30 2.3 02_02_0240 + 8196140-8198248,8198381-8198650 30 2.3 01_01_0796 + 6190931-6192745 30 2.3 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 29 2.6 11_01_0801 - 7071455-7071847 30 3.0 11_01_0133 + 1121392-1122731,1123417-1123858 30 3.0 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 30 3.0 09_02_0495 + 9880714-9881196 30 3.0 08_02_0309 - 15622877-15623710 30 3.0 06_03_1310 + 29238644-29240260 30 3.0 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 30 3.0 06_01_0931 + 7192519-7194075 30 3.0 06_01_0486 - 3455030-3455770 30 3.0 05_07_0236 - 28582157-28582552,28582639-28582911,28583324-285835... 30 3.0 05_07_0054 + 27368832-27369287 30 3.0 02_04_0179 + 20682852-20684510,20684593-20684661,20684741-206848... 30 3.0 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 30 3.0 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 30 3.0 01_06_1724 - 39452858-39454309 30 3.0 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 30 3.0 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 30 3.0 11_06_0202 - 21184217-21184503,21184622-21184982 29 4.0 08_02_1063 + 24024030-24024506,24024803-24024856,24024965-240251... 29 4.0 08_02_0759 - 20851828-20851932,20852190-20852285,20853231-208533... 29 4.0 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 29 4.0 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 29 4.0 06_01_0807 - 6069998-6071326 29 4.0 04_04_1542 - 34264994-34265331,34266195-34267029 29 4.0 02_05_0568 - 30034280-30034393,30034888-30035163,30035246-300353... 29 4.0 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 29 4.0 01_06_1377 + 36764461-36765339 29 4.0 02_01_0016 + 110796-110979,111252-111768,111847-112213 24 4.9 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 29 5.3 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 29 5.3 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 29 5.3 08_02_1256 + 25645085-25645396 29 5.3 08_02_0627 + 19449196-19449651,19449723-19449861,19450260-194503... 29 5.3 08_01_0805 - 7776999-7777241,7777365-7777499 29 5.3 08_01_0059 - 394001-394708 29 5.3 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 29 5.3 05_01_0380 + 2978256-2979284 29 5.3 04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 29 5.3 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 29 5.3 02_04_0029 + 19036176-19036481,19036602-19036733,19036814-190369... 29 5.3 01_05_0669 - 24152057-24152110,24152224-24152308,24152401-241524... 29 5.3 01_01_0876 + 6862321-6862398,6862442-6862747 29 5.3 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 24 6.3 09_04_0616 + 18977421-18977907,18977984-18978245,18978903-18979149 29 7.0 09_04_0258 - 16175258-16176069,16176111-16176414 29 7.0 09_02_0369 - 8012470-8013120 29 7.0 07_03_1382 - 26170563-26170631,26171151-26171843 29 7.0 07_01_1143 - 10711023-10711884,10713603-10713826,10714253-107145... 29 7.0 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 7.0 04_04_1407 - 33345230-33345372,33345492-33345626,33346559-33346904 29 7.0 04_04_0746 + 27726736-27727118,27727518-27727544,27728042-277281... 29 7.0 04_03_0803 - 19835284-19836050,19836337-19836418 29 7.0 03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828,997... 29 7.0 02_05_0543 + 29872168-29872767,29873089-29873115 29 7.0 01_06_1731 + 39516897-39517632,39517744-39517912,39517985-395184... 29 7.0 01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536,787... 29 7.0 12_02_1063 - 25769821-25770365,25770513-25771010,25771394-25771406 28 9.3 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 28 9.3 10_03_0023 - 7151465-7152111,7152222-7152405 28 9.3 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 28 9.3 07_03_1140 - 24258627-24258849,24259967-24260089,24260200-242609... 28 9.3 07_03_0698 - 20765305-20768526 28 9.3 07_03_0435 + 18182657-18183509,18184477-18184574,18184663-181848... 28 9.3 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 28 9.3 06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700,336... 28 9.3 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 28 9.3 05_01_0141 - 937428-937717,938483-938705 28 9.3 03_02_0850 + 11775232-11776077,11776761-11777321 28 9.3 02_04_0177 + 20669053-20669055,20669150-20669198,20669680-206699... 28 9.3 02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242,881... 28 9.3 01_05_0490 + 22672241-22674679 28 9.3 01_05_0433 - 22094784-22095659 28 9.3 01_01_0046 - 331758-332627 28 9.3 >01_07_0082 - 40965947-40967023 Length = 358 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 PPP +G G P PPP + G PPPPP GG Sbjct: 256 PPPQYGYGYPAQPPPPQAGYGYPPPPPQAGYGG 288 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 669 FPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 +P PPP G G P PP GG PP GG Sbjct: 264 YPAQPPPPQAGYGYPPPPPQAGYGGGYGYPPQAGYGG 300 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFFXXXKR 526 PP P P PPP G P PP GG PPPPPP G P Sbjct: 267 PPPPQVPPPPPQAPP-PPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPPPM 325 Query: 525 XGG 517 GG Sbjct: 326 TGG 328 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = -2 Query: 702 PXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPP---PPPPXXGGGXPXF 544 P P P PPP GG P PPP G PP PPPP GG F Sbjct: 280 PPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANG--PPRSIPPPPMTGGAMANF 333 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPPXXXGGXTXFFXXGXKXGGAPXXKXPXXP 488 PP G PPP V G PPPPPP G GGA P P Sbjct: 284 PPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPPPMTGGAMANFTPGAP 338 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = -2 Query: 648 PXFGGGXPXXPPPX--EXGGXXPPPPPPXXGGGXP 550 P GG P PPP PPPPPP G P Sbjct: 258 PNGSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMP 292 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXG---GXXPPPPPPXXGGGXP 550 P PPP P PPP G P PPP GG P Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQP 305 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP G P PPP + GG PPPPPP Sbjct: 921 PPPRPPGAPPPPPPPGKPGGPPPPPPPP 948 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGG 557 PPPP G PPPPPP GG Sbjct: 920 PPPPRPPGAPPPPPPPGKPGG 940 Score = 35.1 bits (77), Expect = 0.081 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 667 SXFXXPPXFWGGKXXXPPPPXVXGXXPPPPPP 572 S PP G PPPP G PPPPPP Sbjct: 916 SALSPPPPRPPGAPPPPPPPGKPGGPPPPPPP 947 Score = 31.9 bits (69), Expect = 0.75 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 618 PPPXEXGGXXPPPPPPXXGGGXP 550 PPP G PPPPP GG P Sbjct: 921 PPPRPPGAPPPPPPPGKPGGPPP 943 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 P PP F GG P PP GG PPPPPP GG Sbjct: 1161 PAPPPPAGFRGGTP---PPNAHGGVAPPPPPPRGHGG 1194 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 PPP G G P PPP GG PPPP GG Sbjct: 1100 PPPSIGAGAPPPPPPP--GGITGVPPPPPIGG 1129 Score = 36.3 bits (80), Expect = 0.035 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P P P GG P PP GG PPPP GG P Sbjct: 1136 PPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTP 1174 Score = 35.1 bits (77), Expect = 0.081 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 666 PXFXPP-PXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 P PP P G PPP G PPPPPP G Sbjct: 1082 PPLPPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGG 1117 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP G PPP G PPPPPP G P Sbjct: 1089 PPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVP 1122 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = -2 Query: 654 PPPXFGG----GXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP GG P PP E G PPPPP GG P Sbjct: 1123 PPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPP 1161 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP GG P PPP GG PP PP Sbjct: 1175 PPNAHGGVAPPPPPPRGHGGVGGPPTPP 1202 Score = 32.3 bits (70), Expect = 0.57 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 654 PPPXFGG--GXPXXPPPXEXGGXXPPPPPPXXGG 559 PPP GG G P PP GG PP PP G Sbjct: 1111 PPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEG 1144 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 517 PPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 PP P PP G GG PP GG PP+ GG Sbjct: 1149 PPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGG 1194 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = -2 Query: 636 GGXPXXPPPXEX--GGXXPPPPPPXXGGGXP 550 GG P PPP G PPPP G G P Sbjct: 1079 GGIPPLPPPLPPTLGDYGVAPPPPSIGAGAP 1109 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G G PP G PP PP GG P Sbjct: 1186 PPPPRGHGGVGGPPTPP-GAPAPPMPPGVPGGPPP 1219 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 511 LGPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGG 651 L PP P G PP G G PP GG PP GG Sbjct: 1084 LPPPLP-PTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPPPPIGG 1129 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = -2 Query: 654 PPPXFGGGXPXXP-PPXEXGGXXPP-----PPPPXXGGGXP 550 PPP GG P PP PP PPPP G G P Sbjct: 1187 PPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRGLP 1227 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 305 PXFFRGXXPXPXXFFFFXGPXXPPFGGGGXXGP 207 P FRG P P P PP G GG GP Sbjct: 1166 PAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGP 1198 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXG--XXPPPPPPXXXGG 557 PP G PPPP G PPPPP GG Sbjct: 1099 PPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLGG 1132 Score = 28.3 bits (60), Expect = 9.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 517 PPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 PP P G PP GG GG P G PP GG Sbjct: 1136 PPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGG 1181 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPP 577 P P P G P PPP G P PP Sbjct: 1201 PPGAPAPPMPPGVPGGPPPPPGGRGLPAPP 1230 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PPP G P PPP + GG PPPPPP G Sbjct: 616 PPPRPPGAPPPPPPPGKPGG--PPPPPPRPG 644 Score = 35.9 bits (79), Expect = 0.046 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGG 557 PPPP G PPPPPP GG Sbjct: 615 PPPPRPPGAPPPPPPPGKPGG 635 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 667 SXFXXPPXFWGGKXXXPPPPXVXGXXPPPPP 575 S PP G PPPP G PPPPP Sbjct: 611 SALPPPPPRPPGAPPPPPPPGKPGGPPPPPP 641 Score = 31.9 bits (69), Expect = 0.75 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 618 PPPXEXGGXXPPPPPPXXGGGXP 550 PPP G PPPPP GG P Sbjct: 616 PPPRPPGAPPPPPPPGKPGGPPP 638 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P P PPP P PP + GG PPPPPP G P Sbjct: 340 PPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGG--PPPPPPKGGASRP 389 Score = 36.3 bits (80), Expect = 0.035 Identities = 21/66 (31%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXP-PPXEXGGXXPPPPPPXXGGGXPXFFXXX 532 +PP P P PPP P PP PPPPPP G P Sbjct: 312 APPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPG 371 Query: 531 KRXGGP 514 + GGP Sbjct: 372 GKKGGP 377 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP GG PPP GG PP P Sbjct: 362 PSPPPPPPPGGKKGGPPPPPPKGGASRPPAAP 393 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPP 639 GPP P PP GG GG PP GG + P Sbjct: 352 GPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAP 393 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPPXXXGGXTXFFXXGXKXGGA 515 PP G PPPP PPPPPP G G G A Sbjct: 356 PPPPKGPSPPPPPPPGGKKGGPPPPPP-KGGASRPPAAPGVPTGSA 400 >07_01_0479 + 3606663-3607448 Length = 261 Score = 37.5 bits (83), Expect = 0.015 Identities = 29/90 (32%), Positives = 30/90 (33%) Frame = -2 Query: 819 PPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPXF 640 PP P F PPG G F PP P + P PPP Sbjct: 176 PPMRPPQMPIPFQRPPGVPPAFPGGPPPPPGP--FMRGPPPMGPPQVRPGMPG-GPPP-- 230 Query: 639 GGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 G P PPP G PPPP P G P Sbjct: 231 -GMRPGMPPPPFRPGMPPPPPGPQQPGQNP 259 Score = 30.3 bits (65), Expect = 2.3 Identities = 23/74 (31%), Positives = 26/74 (35%), Gaps = 1/74 (1%) Frame = -1 Query: 706 PPLXXRXLXKXFFSXFXXPPXFWGGKXXXPPPPXVXGXXPPPP-PPXXXGGXTXFFXXGX 530 PP+ + F PP F GG PPPP PPP PP G G Sbjct: 176 PPMRPPQMPIPFQRPPGVPPAFPGGP---PPPPGPFMRGPPPMGPPQVRPGMPGGPPPGM 232 Query: 529 KXGGAPXXKXPXXP 488 + G P P P Sbjct: 233 RPGMPPPPFRPGMP 246 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 637 GGKXXXPPPPXVXGXXPPPPPPXXXG 560 G + PPPP G PPPP P G Sbjct: 231 GMRPGMPPPPFRPGMPPPPPGPQQPG 256 Score = 28.7 bits (61), Expect = 7.0 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = -2 Query: 702 PXXXXPXXKXFFPXFXPPPX--FGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFF 541 P P FP PPP F G P PP G PPP G P F Sbjct: 186 PFQRPPGVPPAFPGGPPPPPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPF 241 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPP 583 PPP F G P PP + G PP Sbjct: 237 PPPPFRPGMPPPPPGPQQPGQNPP 260 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 37.1 bits (82), Expect = 0.020 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 PP P P PP G G P PPP G PPPP G Sbjct: 586 PPEPSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMPGSSKTRPPPPLKPG 634 Score = 29.1 bits (62), Expect = 5.3 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 4/56 (7%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFX----PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P K P PP P P P PPPPPP G P Sbjct: 556 PPVMPPPIPKLLSPPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPPPPKSTGPGP 611 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = -1 Query: 619 PPPPXVXGXXPP-PPPPXXXG 560 PPPP G PP PPPP G Sbjct: 601 PPPPKSTGPGPPRPPPPAMPG 621 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 PP GGG P PP GG PP P GGG Sbjct: 108 PPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGG 140 Score = 36.3 bits (80), Expect = 0.035 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 514 GPPX-PFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGGXK 660 GPP P G PP GGGGGG P + GGG + + GG + Sbjct: 116 GPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGR 165 Score = 35.5 bits (78), Expect = 0.061 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 550 GXXPPXXGGGGG-GXXPPXLXGGGXXXXSPPKXGGGXKXXKKXFXXG 687 G PP GGGGG PP GGG P GGG ++ G Sbjct: 105 GARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGG 151 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +1 Query: 559 PPXXGG-----GGGGXXPPXLXGGGXXXXSPPKXGGG 654 PP GG GGGG PP GGG PP GGG Sbjct: 91 PPGGGGAPGPLGGGGARPPGGGGGGGPPSLPPGAGGG 127 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 639 GGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 GGG P PP GG PP P GGG Sbjct: 114 GGGPPSLPPGAGGGGGARPPAPGGGGGG 141 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 550 GXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 G P GGGGG P GGG P GGG Sbjct: 170 GRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGG 204 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +1 Query: 559 PPXXGGGGGG--XXPPXLXGGGXXXXSPPKXGGG 654 PP GGGGGG P GGG +P GGG Sbjct: 172 PPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGG 205 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 559 PPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 PP G GG PP GGG P GGG Sbjct: 160 PPGGGRGGALGRPPGGGGGGGGPGRAPGGGGG 191 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 571 GGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 GGGGG P G G PP GGG Sbjct: 151 GGGGGALARPPGGGRGGALGRPPGGGGG 178 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 P P GGG PP GG P PP GGG Sbjct: 98 PGPLGGGGA--RPPGGGGGGGPPSLPPGAGGGG 128 >08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180, 5263263-5263312,5265266-5265725,5266349-5266708 Length = 434 Score = 35.9 bits (79), Expect = 0.046 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPP 572 PP WG PPPP + G PPPP P Sbjct: 40 PPQMWG--QAPPPPPQMWGQAPPPPQP 64 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G P PPP + G PPPP P G P Sbjct: 39 PPPQMWGQAP--PPPPQMWGQAPPPPQPAYGQPPP 71 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP PPP + G PPPPP G P Sbjct: 26 PPPVPHQQQQYAPPPPQMWGQAPPPPPQMWGQAPP 60 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 34.7 bits (76), Expect = 0.11 Identities = 31/108 (28%), Positives = 35/108 (32%), Gaps = 5/108 (4%) Frame = -2 Query: 822 APPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXX--PXXKXFFPXFXP- 652 +PP PP + PPG Y V SPP P P + P Sbjct: 660 SPPEYAPEPPVYAPYPPGIFPSPPEYSPEPPSYV---PSPPQYAPQPPSYVPSPPEYAPE 716 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG--XPXFFXXXKRXGGP 514 PP + P P PPP PP GGG P F GP Sbjct: 717 PPVYAPYPPGITPSPPEYAPEPPPGPPGGGGGYLPPVVFPPPYASRGP 764 >04_04_1049 + 30414545-30414596,30414732-30414853,30415121-30415198, 30415329-30415459,30415644-30417552,30417797-30417836, 30418194-30418259,30418583-30418734 Length = 849 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXP---PPPPPXXGGGXPXF 544 P + PPP G PPP + G P PPPP G P + Sbjct: 479 PSWVPPPPRGNAPSWVPPPPQPRGNAPSCVPPPPQSRGIAPPEY 522 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P F PPP P P PPPPPP Sbjct: 546 PPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPP 590 Score = 31.9 bits (69), Expect = 0.75 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPP---PPPPXXXG 560 PP G K PPPP PP PPPP G Sbjct: 753 PPLMTGKKAPAPPPPPPQAPKPPGTVPPPPPLHG 786 Score = 31.5 bits (68), Expect = 1.00 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPP-----XEXGGXXPPPPPPXXGGGXP 550 PP K P PPP G PPP + G PPPPP G P Sbjct: 735 PPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPPLHGASGRP 791 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 587 PPPPPPPLPNCLVPS--PPP------PPPPPPILPNRSVPPPPPP 623 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P PPP P PPP PPPP P G P Sbjct: 618 PPPPPPPPPLPNHSVLPPPP------PPPPPPSLPNRLVPPPPAPGIGNKFP 663 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 618 PPPXEXGGXXPPPPPPXXGGGXPXF 544 P P PPPPPP G P F Sbjct: 537 PSPTAAAPPPPPPPPPPPSGNKPAF 561 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 3/31 (9%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXP---PPPPP 571 P P P PPP G P PPPPP Sbjct: 537 PSPTAAAPPPPPPPPPPPSGNKPAFSPPPPP 567 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 P PPP G P P G P PPP G G Sbjct: 775 PGTVPPPPPLHGASGRPHPPSSKGLNAPAPPPLLGRG 811 >07_01_0080 + 587674-588510 Length = 278 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = -2 Query: 651 PPXFGGGX------PXXPPPXEXGGXXPPPPPPXXGGGXPXFFXXXKRXGGPQ 511 PP GG P PPP G PPPPPP P +R PQ Sbjct: 79 PPRLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPPLFTRRSHAPQ 131 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 P PPP G P PPP PPPPP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP G P PPP PPPPPP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPP--PPPPPPPP 121 >12_02_0848 + 23636478-23638058 Length = 526 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Frame = -2 Query: 723 VFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXG----GXXPPPPPPXXG 562 +FFF SP F P P G P PP + PPPPPP G Sbjct: 32 LFFFPSPSPDVAVRRDGFLPAVTLPVQRAGDTPPPPPIIDASPPPPSTSPPPPPPRRG 89 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 33.5 bits (73), Expect = 0.25 Identities = 23/76 (30%), Positives = 25/76 (32%), Gaps = 1/76 (1%) Frame = -2 Query: 798 PPXF-FXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPX 622 PP F F PP + +F SPP P FP P P F Sbjct: 257 PPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPHFPPLPSF 316 Query: 621 XPPPXEXGGXXPPPPP 574 P P PPPPP Sbjct: 317 YPSPPPPPPPPPPPPP 332 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 SPP P +P + PPP F P PP PPPPP Sbjct: 254 SPPPPAFPFPLPPWP-WAPPPAFP--FPHLPPIFSPPSPPPPPPP 295 Score = 29.1 bits (62), Expect = 5.3 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 720 FFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFF 541 F F PP P FP PP F P PPP P PP P F+ Sbjct: 260 FPFPLPPWPWAPPPAFPFPHL--PPIFSPPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFY 317 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 33.5 bits (73), Expect = 0.25 Identities = 27/109 (24%), Positives = 34/109 (31%), Gaps = 6/109 (5%) Frame = -2 Query: 879 PGPLRVFXXKXXXXXXXXGAPPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPP 700 P P+ + PP PP PP G + F PP Sbjct: 22 PPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFN----FGPGPP 77 Query: 699 XXXXPXX--KXFFPXFXPPPXFGGG----XPXXPPPXEXGGXXPPPPPP 571 P + ++ PPP +G P PPP PPPPPP Sbjct: 78 QQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPP 126 Score = 33.5 bits (73), Expect = 0.25 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -2 Query: 714 FXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXX--PPPXEXGGXXPPPPPPXXG 562 F +PP P P P FG G P PPP PPPPPP G Sbjct: 51 FLAPPPPPPPGPP---PPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYG 100 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P PP GG P PPP G PPP P G P Sbjct: 6 PYAPHPPPPQGGFPPQPPPMNPYG-PPPPQQPAYGHMPP 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP + PPPPPP Sbjct: 83 PPPPQMYYQPPPPPPP 98 Score = 28.3 bits (60), Expect = 9.3 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXP---PPPPPXXGGGXP 550 PP P + PPP PPP G P PPPPP G P Sbjct: 13 PPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQ--GAPPPFLAPPPPPPPGPPPP 65 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPP 580 PPP GG PPP + G PPP Sbjct: 5 PPPTMNGGHHAAPPPPQVSGAPPPP 29 Score = 32.3 bits (70), Expect = 0.57 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGG--XXPPPPPPXXGGGXPXFF 541 PP + G P PPP + PPPPPP P F Sbjct: 50 PPHYYQAGPPHAPPPQQPPAMWGQPPPPPPQYAPPPPQQF 89 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 618 PPPXEXGGXXPPPPPPXXGGGXP 550 PPP GG PPPP G P Sbjct: 5 PPPTMNGGHHAAPPPPQVSGAPP 27 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPP 578 PP GG PPPP V PPPP Sbjct: 6 PPTMNGGHHAAPPPPQV-SGAPPPP 29 >03_01_0515 - 3864796-3865425 Length = 209 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P P PPP G P PPP PPPP P Sbjct: 47 SPPPLAPPPSVTSSP---PPPAAGPLMPPPPPPPSVTSSPPPPPLP 89 Score = 31.9 bits (69), Expect = 0.75 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXP--PPXEXGGXXPPPPPP 571 SPP P P PPP P P PP PPPPPP Sbjct: 60 SPPP---PAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 Score = 28.7 bits (61), Expect = 7.0 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 SPP P + P PPP P PP PPPPPP P Sbjct: 38 SPPS---PPTEASPPPLAPPPSVTSSPP---PPAAGPLMPPPPPPPSVTSSPP 84 >11_06_0184 - 21006659-21009823 Length = 1054 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PP G PPP G PPPP P G Sbjct: 289 PPQSDGDDKQQPPPQSDGSDQPPPPQPDGG 318 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = -2 Query: 654 PPPXFGGGXPXXP----PPXEXGGXXPPPPPPXXGGG 556 PPP GGG PP GG PPP GG Sbjct: 236 PPPQSGGGNGIKQQQPLPPQSDGGDKEQPPPSLSDGG 272 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P PPP PPPPPP G P Sbjct: 1161 PPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPP 1194 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPX---FGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P P PPP G P P P PP PPP Sbjct: 1163 SPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPP 1211 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPP--PXFGGGXPXX---PPPXEXGGXXPPPPPPXXGGGXP 550 +PP P P PP P P PPP PPPPPP G P Sbjct: 1136 APPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPP 1193 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP + G P PPP PPPPP G P Sbjct: 6 PPPQWAMGPP--PPPQYFQAGPPPPPPQYFQGAHP 38 Score = 31.9 bits (69), Expect = 0.75 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPPXXXGG 557 PP W PPPP PPPPPP G Sbjct: 6 PPPQWA--MGPPPPPQYFQAGPPPPPPQYFQG 35 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 6/34 (17%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPP------PPPP 571 PPP + P PPP G PP PPPP Sbjct: 16 PPPQYFQAGPPPPPPQYFQGAHPPAAMWGQPPPP 49 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGG 557 PPPP PPPPPP GG Sbjct: 54 PPPPPPTQPAPPPPPPARSGG 74 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPPXXGGG 556 P PPP PPPPP GGG Sbjct: 52 PPPPPPPPTQPAPPPPPPARSGGG 75 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPPXXGGG 556 P PPP PPPP GGG Sbjct: 53 PPPPPPPTQPAPPPPPPARSGGGG 76 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P PPP P PPP PPPPP G P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 P PPP P PPP G PP PP Sbjct: 360 PPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 558 PPXXXGGGGGGFXPXTXGGGGXXXFPP 638 PP GGGGGG GGGG PP Sbjct: 115 PPTGGGGGGGGGWQQGGGGGGAYPTPP 141 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 559 PPXXGGGGGGXXPPXLXGGGXXXXSPP 639 PP GGGGGG GGG +PP Sbjct: 115 PPTGGGGGGGGGWQQGGGGGGAYPTPP 141 Score = 29.1 bits (62), Expect = 5.3 Identities = 27/88 (30%), Positives = 30/88 (34%), Gaps = 6/88 (6%) Frame = -2 Query: 816 PTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPX----FXPP 649 PT PP + P GGGG GG + SPP + PP Sbjct: 65 PTPQCPPPPSY--PSGGGGGG-------GGGTVMYTSPPPPYSGGGGGSSTGGGGIYYPP 115 Query: 648 PXFGGGXPXX--PPPXEXGGXXPPPPPP 571 P GGG GG P PPPP Sbjct: 116 PTGGGGGGGGGWQQGGGGGGAYPTPPPP 143 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 561 PXXXGGGGGGFXPXTXGGGGXXXFP 635 P GGGGGG GGGG +P Sbjct: 114 PPPTGGGGGGGGGWQQGGGGGGAYP 138 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 32.3 bits (70), Expect = 0.57 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 634 GKXXXPPPPXVXGXXPPPPPP 572 G PPPP V PPPPPP Sbjct: 135 GPGQEPPPPHVPKAAPPPPPP 155 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP P PPP PP PPP G P Sbjct: 141 PPPHVPKAAPPPPPPPPP--HAPPGPPPTKGVATP 173 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PP P P PPP P PPP P PP G Sbjct: 221 PPPPPPPPSPHRHPAAHPPPPPHHPAPRPPPPMAAAPRQPAALPPVPG 268 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 32.3 bits (70), Expect = 0.57 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P F PPP P PPP PPPPPP Sbjct: 43 PRFAPPPP----QPTLPPPPPRTLPPPPPPPP 70 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 56 PPPPRTLPPPPPPPPP 71 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 31.9 bits (69), Expect = 0.75 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXG-GXXPPPPPPXXGGGXPXF 544 PPP G P PP G PPPPPP G P + Sbjct: 249 PPPGQGPVPPRDAPPMHHAQGNVPPPPPP--NAGPPNY 284 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 31.5 bits (68), Expect = 1.00 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PP PPPPPP Sbjct: 21 PPPSSSSPSPPVPPDPYGADLSPPPPPP 48 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.5 bits (68), Expect = 1.00 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP P PPP PPPPPP G P Sbjct: 10 PPPRL---LPPQPPPTSRPLPPPPPPPPPAHGPSP 41 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPP 577 PPP P PPP G PPPP Sbjct: 19 PPPTSRPLPPPPPPPPPAHGPSPPPP 44 >06_01_1050 + 8262033-8262165,8262262-8262391,8262486-8263026 Length = 267 Score = 31.5 bits (68), Expect = 1.00 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPP 571 P PPP E PPPPPP Sbjct: 131 PPRPPPREQDATPPPPPPP 149 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 31.5 bits (68), Expect = 1.00 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G PPP PPP PP G P Sbjct: 636 PPPSMANGAGPVPPPI---AVAPPPAPPIAGAAPP 667 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PPP P PPP G P PPP Sbjct: 625 PPPMMANAAP-VPPPSMANGAGPVPPP 650 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 31.5 bits (68), Expect = 1.00 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPPPP 378 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -2 Query: 687 PXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P + P PPP P PPP P PPPP Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPP 376 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP + PPPPP Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPP 377 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PP PPPPPP Sbjct: 352 PPPPPPPPPPPPPPKLNTAPKPPPPPPP 379 >02_05_0742 + 31415862-31417088 Length = 408 Score = 25.4 bits (53), Expect(2) = 1.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGG 620 GGGGGG GGGG Sbjct: 379 GGGGGGSSQQQHGGGG 394 Score = 24.2 bits (50), Expect(2) = 1.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 516 APPXFXPXKKKXVXPPXXXGGGGGG 590 AP P ++ + P GGGGGG Sbjct: 326 APMALLPGQQLGLGPVGGGGGGGGG 350 >07_03_1713 + 28939446-28939574,28939674-28940231,28940338-28940460, 28940676-28940912 Length = 348 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 640 WGGKXXXPPPPXVXGXXPPPPPP 572 WG + PPPP G PPPP Sbjct: 119 WGPEAYAPPPPPAYGHQAYPPPP 141 >06_01_1013 - 7931756-7935109 Length = 1117 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 639 GGGXPXXPPPXEXGGXXPPPPPP 571 GGG PP E PPPPPP Sbjct: 79 GGGGQRRGPPQERPSAAPPPPPP 101 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP V PPPPPP Sbjct: 18 PPPPPVQVPVPPPPPP 33 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 19 PPPPVQVPVPPPPPPP 34 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 517 PPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 PP G PP GG GG P GGG PP GGG Sbjct: 361 PPYSGGAPGGQGSLPPSYDGGYGGRPMP---GGGGPGAPPPYHGGG 403 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 PPP GG P PP PPP PP GG Sbjct: 338 PPPSSYGGGPGSYPPSYGA---PPPNPPYSGG 366 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 PP + GG P P G PPP GGG Sbjct: 375 PPSYDGGYGGRPMPGGGGPGAPPPYHGGGGGG 406 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGGXXXFPPQXXGG 653 GGGGGG+ GGGG + GG Sbjct: 79 GGGGGGYGGGGRGGGGGGGYGGGGGGG 105 >11_01_0359 - 2731522-2732346 Length = 274 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 Query: 669 FPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 +P PPP P PP PPPPPP Sbjct: 39 YPYPAPPPHSHSHPPPPPPHAYHHHHYPPPPPP 71 >09_06_0172 + 21329904-21331512,21331595-21331740,21332333-21332556, 21333689-21334448 Length = 912 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 P PPP +G G PPP G P P GGG Sbjct: 163 PQMGPPPPYGSGY-APPPPYGSGYGYGYGPAPDYGGG 198 >09_06_0125 - 21011757-21012428 Length = 223 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXG 560 PPPP PPPPPP G Sbjct: 173 PPPPRAPFLAPPPPPPVGSG 192 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPPXXGGG 556 P PPP PPPPP G G Sbjct: 169 PSPPPPPPRAPFLAPPPPPPVGSG 192 >07_03_0890 - 22332768-22333382 Length = 204 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 75 PPPPPAEATPPPPPPP 90 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 76 PPPPAEATPPPPPPPP 91 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -2 Query: 618 PPPXEXGGXXPPPPPP 571 PPP E PPPPPP Sbjct: 77 PPPAEATPPPPPPPPP 92 >05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 Length = 368 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/56 (37%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +3 Query: 489 GXXGXLXXGAPPX-FXPXKKKXVXPPXXXGGGGGGFXPXTXGGGGXXXFPPQXXGG 653 G G APP P K+ V PP GGGGG GGGG + GG Sbjct: 179 GQGGGAGAVAPPFAMTPHGKQPVAPPGNGNGGGGG------GGGGGKKKGKKGGGG 228 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +1 Query: 517 PPXPFXXXKKXGXXPPXX--GGGGGGXXPPXLXGGGXXXXSPP 639 P P G PP G GGGG PP L GG PP Sbjct: 358 PAAPRPPGPGPGPPPPPGAAGRGGGGPPPPALPGGPRARGPPP 400 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXG-GXXPPPPPPXXGG 559 P PP G G P PPP G G PPPP GG Sbjct: 358 PAAPRPPGPGPGPP--PPPGAAGRGGGGPPPPALPGG 392 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGGXK 660 GPP P PP G G G PP G G PP GG + Sbjct: 348 GPPPPPPPAAPAAPRPP--GPGPGPPPPPGAAGRGGGGPPPPALPGGPR 394 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -2 Query: 654 PPPXFGGGXPXXP-PPXEXGGXXPPPPPPXXGGGXP 550 PPP P P PP G PPP GGG P Sbjct: 349 PPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGP 384 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -1 Query: 649 PXFWGGKXXXPPPPXVXGXXPPPPPPXXXGGXTXFFXXGXKXGGAPXXKXPXXPR 485 P G PPPP P PP G G GG P P PR Sbjct: 340 PSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPPALPGGPR 394 Score = 28.7 bits (61), Expect = 7.0 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P P P G G PPP P PP P G P Sbjct: 322 PPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPP 373 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGGXXXFPPQXXG 650 GGGGGG GGGG +PP G Sbjct: 75 GGGGGGGGGGGGGGGGGGYYPPWNGG 100 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGGXXXFPPQXXGG 653 GGGGGG GGGG + P GG Sbjct: 74 GGGGGGGGGGGGGGGGGGGYYPPWNGG 100 >02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787, 6435281-6435392,6435473-6435517,6435622-6435726, 6435946-6435996,6436026-6436103,6437258-6437313, 6437784-6437853,6438288-6438392,6438525-6438637, 6439354-6439534,6439635-6440390 Length = 710 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPX-EXGGXXPPPPPP 571 P F PPP G P PP GG PPPP Sbjct: 62 PPFPPPPGMLHGEPYPPPDRFGYGGGRGYPPPP 94 >01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 Length = 301 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 562 PXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 P GGG GG P GGG SP GG Sbjct: 124 PSPGGGYGGGSPAPSHGGGAYGSSPSTPSGG 154 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = -2 Query: 654 PPPXFGGGX----PXXPPPXEXGGXXPPPPPPXXGGG 556 PPP G P P P PPPPPP GG Sbjct: 162 PPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPPAGG 198 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 616 PPPXVXGXXPPPPPPXXXGGXT 551 P P G PPPPPP G T Sbjct: 180 PAPAPAGSPPPPPPPPAGGNFT 201 >12_02_1174 - 26696869-26698191 Length = 440 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -2 Query: 705 PPXXXXPXXKXFF-PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P + P PPP P PPP PPP PP Sbjct: 123 PPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPP 168 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPP 571 P PPP E PPPPPP Sbjct: 148 PPPPPPQESTPPPPPPPPP 166 >10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081, 7040633-7041213 Length = 426 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/52 (32%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFX-----PPPXFGGGXPXXPPPXEXGGXX--PPPPPP 571 PP P ++P + PPP G P GG PPPPPP Sbjct: 54 PPQYPNPNLPQYYPQYGNFYPPPPPSMPGPLPAPYDHHHRGGGPAQPPPPPP 105 Score = 29.1 bits (62), Expect = 5.3 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFFXXXKRXGGP 514 PP + P P G PPPPP G P + R GGP Sbjct: 54 PPQYPN--PNLPQYYPQYGNFYPPPPPSMPGPLPAPYDHHHRGGGP 97 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP + PPPPPP Sbjct: 425 PPPPPLPPPPPPPPPP 440 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 426 PPPPLPPPPPPPPPPP 441 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPP 572 PP F PPP PPPPPP Sbjct: 15 PPPFSSRPRVVGPPPPPPSDPPPPPPP 41 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 PPP + PPP G P PP G G Sbjct: 64 PPPQYAKHFAAGPPPAAAAGRRTPTPPAPAGSG 96 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 51 PPPPPPMVAAPPPPPP 66 >03_05_1081 + 30235677-30236474 Length = 265 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPP 577 P + PPP P PPP G PPPP Sbjct: 37 PTYPPPP---SAYPAAPPPPVMGQPVPPPP 63 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P G P PPP GG P PPP Sbjct: 11 PDGDGDSHPQQPPPPPPGGGAKPEPPP 37 >01_01_0796 + 6190931-6192745 Length = 604 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPP--PPPPXXG 562 PPP P PPP G P PPPP G Sbjct: 229 PPPFVADQPPPPPPPAAGGSLWIPELPPPPVEG 261 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 616 PPPXVXGXXPPPPPPXXXG 560 PPP V PPPPPP G Sbjct: 229 PPPFVADQPPPPPPPAAGG 247 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 P PPP P P PPPPPP G Sbjct: 30 PPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVG 64 Score = 27.1 bits (57), Expect(2) = 2.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 640 WGGKXXXPPPPXVXGXXPPPPPP 572 W + PPPP PPPPPP Sbjct: 19 WPPELRLPPPPP---PHPPPPPP 38 Score = 21.4 bits (43), Expect(2) = 2.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -1 Query: 589 PPPPPPXXXGG 557 PPPPPP G Sbjct: 57 PPPPPPVGPPG 67 >11_01_0801 - 7071455-7071847 Length = 130 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = -2 Query: 654 PPPXFGGGXPXXP-PPXEXGGXXPPPPPPXXG 562 PPP FG P P PP P P PP G Sbjct: 44 PPPRFGADSPLRPAPPPRRRLGLPHPQPPYSG 75 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 154 PPPPTSVAALPPPPPP 169 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 73 PPPPQTPPSPPPPPPP 88 >09_02_0495 + 9880714-9881196 Length = 160 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 598 GXXPPPPPPXXXGGXTXFFXXGXKXGGAPXXKXPXXP 488 G PPPPP G F G G AP P P Sbjct: 77 GTYPPPPPGVMPGAFAPPFGGGFPYGPAPPPPNPILP 113 >08_02_0309 - 15622877-15623710 Length = 277 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGG 557 PPPP PPPPP GG Sbjct: 71 PPPPSATTAPPPPPPRAPPGG 91 >06_03_1310 + 29238644-29240260 Length = 538 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPP 575 PP GGK PP V PPPPP Sbjct: 487 PPQGGGGKLPFPPVHGVAYSSPPPPP 512 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXG 560 PPPP PPPPPP G Sbjct: 9 PPPPHSSYAAPPPPPPPPPG 28 >06_01_0931 + 7192519-7194075 Length = 518 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 132 PPPPPPRSQAPPPPPP 147 >06_01_0486 - 3455030-3455770 Length = 246 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P P + P + PPP P PPP PPP PP Sbjct: 88 PTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPPTPP--YVPPPTPP 130 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = -2 Query: 702 PXXXXPXXKXFFPXFXPPPXFGGGXPXXP--PPXEXGGXXPPPPPP 571 P P + P + PPP P P PP PP PPP Sbjct: 101 PPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPP 146 >05_07_0236 - 28582157-28582552,28582639-28582911,28583324-28583560, 28583653-28583694,28583782-28583964,28584393-28584524, 28585605-28586057 Length = 571 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP G G PP PPP PP Sbjct: 98 PPPSSGSGHTLPSPPPPLPPLLPPPQPP 125 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPPXXXGGXTXF 545 PP G PPP + PPP PP T F Sbjct: 99 PPSSGSGHTLPSPPPPLPPLLPPPQPPAAQSQNTVF 134 >05_07_0054 + 27368832-27369287 Length = 151 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = -2 Query: 654 PPPXFGGGXPXXP-PPXEXGGXXPPPPPPXXG 562 PPP FG P P PP P P PP G Sbjct: 65 PPPRFGADGPLRPAPPPRRRLGLPHPQPPYSG 96 >02_04_0179 + 20682852-20684510,20684593-20684661,20684741-20684809, 20686779-20688206 Length = 1074 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP + G PPPPP Sbjct: 24 PPPPLLTGTAVPPPPP 39 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 29.9 bits (64), Expect = 3.0 Identities = 20/67 (29%), Positives = 22/67 (32%) Frame = -2 Query: 771 GGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGX 592 GGG +Y G + PP P K F PP P PPP Sbjct: 90 GGGDGRSWYSWNGGRTAKPYRPPPP---PRKKPQFQPPPQPPRAWDPSPPPPPPAPAAPV 146 Query: 591 XPPPPPP 571 PPP P Sbjct: 147 LVPPPAP 153 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PP P + P PPP P PPP G P P P G Sbjct: 432 PPPEHPPPPESTSP---PPPPTSDPPPVPPPPPTTGSFMPIPSAPFAG 476 >01_06_1724 - 39452858-39454309 Length = 483 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP + PPPPPP Sbjct: 347 PPPPCLAYQMPPPPPP 362 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 640 WGGKXXXPPPPXVXGXXPPPPPP 572 +G PPPP PPPPPP Sbjct: 351 FGQPPAPPPPPPFAPTLPPPPPP 373 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 412 PPPPPTHTHGPPPPPP 427 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPP G PPPPPP Sbjct: 414 PPPTHTHGPPPPPPPP 429 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 413 PPPPTHTHGPPPPPPP 428 Score = 27.5 bits (58), Expect(2) = 3.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP F P PPP PP P Sbjct: 355 PAPPPPPPFAPTLPPPPPPRRKPPSPSPPSSP 386 Score = 20.6 bits (41), Expect(2) = 3.5 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 585 PPPPPXXGGGXP 550 PPPPP G P Sbjct: 412 PPPPPTHTHGPP 423 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 PPP P PPP G PPP GG Sbjct: 75 PPPTPPSPPPPPPPPPTNGTLTPPPSSAPSGG 106 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 616 PPPXVXGXXPPPPPPXXXGGXT 551 PPP PPPPPP G T Sbjct: 75 PPPTPPSPPPPPPPPPTNGTLT 96 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 PP P PPP G PPP GG Sbjct: 75 PPPTPPSPPPPPPPPPTNGTLTPPPSSAPSGG 106 >11_06_0202 - 21184217-21184503,21184622-21184982 Length = 215 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPPXXGGG 556 P PPP PPPPPP G Sbjct: 167 PSSPPPFTSPSPLPPPPPPPTSHG 190 >08_02_1063 + 24024030-24024506,24024803-24024856,24024965-24025118, 24025314-24025388,24025511-24025788,24026023-24026253, 24026522-24026620,24026740-24026889,24027830-24027976, 24028525-24028575,24028647-24028819,24029018-24029147, 24029361-24029458,24029655-24029892,24030634-24030837, 24031003-24031083,24031296-24031535 Length = 959 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 558 PPXXXGGGGGGFXPXTXGGGGXXXFPPQXXG 650 PP GGGGGG GGGG P G Sbjct: 109 PPRGGGGGGGGDGGGGGGGGGGWKRPRASQG 139 >08_02_0759 - 20851828-20851932,20852190-20852285,20853231-20853314, 20853411-20853481,20853568-20853655,20853745-20853936, 20854044-20854931 Length = 507 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 Query: 618 PPPXEXGGXXPPPPPPXXGGGXP 550 PPP + PPPPPP P Sbjct: 146 PPPSDAAAPPPPPPPPAAAPAAP 168 >07_03_1573 + 27829967-27830338,27830821-27831510,27831594-27831781, 27832286-27832318,27832364-27832605,27833178-27833320, 27833649-27833825,27834104-27834256,27834639-27834694, 27834998-27835157,27835301-27835348 Length = 753 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGG 557 PPPP PPPPPP G Sbjct: 36 PPPPPPRRRTPPPPPPGSGPG 56 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 571 GGGGGGXXPPXLXGGG 618 GGGGGG PP GGG Sbjct: 60 GGGGGGGGPPYYGGGG 75 >06_01_0807 - 6069998-6071326 Length = 442 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGG 620 GGGGGGF + GGGG Sbjct: 42 GGGGGGFMAPSGGGGG 57 >04_04_1542 - 34264994-34265331,34266195-34267029 Length = 390 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP + PPPPPP Sbjct: 217 PPPPPLALPLPPPPPP 232 >02_05_0568 - 30034280-30034393,30034888-30035163,30035246-30035371, 30035595-30035753,30035893-30036063,30036374-30036493, 30036565-30036924,30038800-30039686,30039790-30040363, 30041379-30041507,30042423-30042494,30042572-30042728, 30042974-30043023,30043569-30044327 Length = 1317 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 649 PXFWGGKXXXPPPPXVXGXXPPPPPP 572 P F GG PPPP PP PP Sbjct: 35 PIFPGGPAAGPPPPSAAYSYPPATPP 60 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 666 PXFXPPPXFG--GGXPXXPPPXEXGGXXPPPPPP 571 P PPP FG GG P + PPPPPP Sbjct: 11 PPPPPPPPFGRGGGGAGYPRGHKQLYAPPPPPPP 44 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 589 PPPPPPXXXGGXTXFFXXGXKXGGAPXXKXP 497 PPPPPP GG + G K AP P Sbjct: 13 PPPPPPFGRGGGGAGYPRGHKQLYAPPPPPP 43 >01_06_1377 + 36764461-36765339 Length = 292 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP P PPP PPPPPP P Sbjct: 155 PPPP----EPQYPPPSSSPYYFPPPPPPAYSAPPP 185 >02_01_0016 + 110796-110979,111252-111768,111847-112213 Length = 355 Score = 24.2 bits (50), Expect(2) = 4.9 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PP V PPPPPP Sbjct: 207 PPSLPVDTMPPPPPPP 222 Score = 23.4 bits (48), Expect(2) = 4.9 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -1 Query: 589 PPPPPPXXXGGXTXF 545 PPPPPP G F Sbjct: 219 PPPPPPQPQGSACTF 233 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PP P + P PPP P PPP PPPP Sbjct: 71 PPPQPQPEPQPAAPSQPPPPQ---EQPSPPPPASSNTTQQPPPP 111 >11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 Length = 306 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 558 PPXXXGGGGGGFXPXTXGGGG 620 PP GGGGGG+ P G G Sbjct: 271 PPCYSGGGGGGYTPYCGGYSG 291 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP P PPP P PPPP Sbjct: 323 PPSNPPP---APPPPPPPPSRFNNTTPKPPPP 351 >08_02_1256 + 25645085-25645396 Length = 103 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 64 PPPPPPLPSPPPPPPP 79 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 63 PPPPPPPLPSPPPPPP 78 >08_02_0627 + 19449196-19449651,19449723-19449861,19450260-19450381, 19450685-19450888,19450981-19451040,19451628-19451820, 19451880-19451998,19452189-19452413,19452534-19452728 Length = 570 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 534 PXKKKXVXPPXXXGGGGGGFXPXT 605 P + V PP GGGGGG P T Sbjct: 64 PSTRGSVQPPPDYGGGGGGAGPGT 87 >08_01_0805 - 7776999-7777241,7777365-7777499 Length = 125 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 600 GGXXPPPPPPXXGGG 556 GG PPPPPP GG Sbjct: 106 GGDSPPPPPPPAAGG 120 >08_01_0059 - 394001-394708 Length = 235 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P P PPP P PPP P PPPP Sbjct: 29 SPPIRPPPPPTPR-PYAPPPP----SHPLAPPPPHISPPAPVPPPP 69 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 48 PPPPPQPHTAPPPPPP 63 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 26 PPPPPPPPPPPPPPPP 41 >04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 Length = 676 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXP---PPPPPXXGGGXPXF 544 PPP G P P GG P PPPP G P + Sbjct: 489 PPPPRGNPPSWVPLPPPPGGNAPSWVPPPPQPRGIAPPEY 528 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 38 PPPPPPPPPPPPPPPP 53 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 39 PPPPPPPPPPPPPPPP 54 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 40 PPPPPPPPPPPPPPPP 55 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 41 PPPPPPPPPPPPPPPP 56 >02_04_0029 + 19036176-19036481,19036602-19036733,19036814-19036933, 19037763-19037837,19038282-19038392,19038528-19038635, 19038865-19038933,19038934-19039004,19039095-19039147, 19039223-19039326,19039424-19039696 Length = 473 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 616 PPPXVXGXXPPPPPPXXXGGXT 551 PPP PPPPPP G T Sbjct: 43 PPPPSSSSSPPPPPPSSVEGRT 64 >01_05_0669 - 24152057-24152110,24152224-24152308,24152401-24152486, 24153129-24154341,24154441-24154529,24154607-24154639, 24154674-24154859,24155290-24155380,24155588-24155622, 24155736-24155817,24155968-24156020,24156404-24156469, 24156752-24156820,24156821-24156984,24157925-24158432, 24158543-24158602 Length = 957 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 Query: 615 PPXEXGGXXPPPPPPXXGGGXPXFFXXXKRXGGP 514 PP G PP PPP G P + ++ G P Sbjct: 75 PPPSLYGYAPPQPPPALYGAVPYNYGHPQQPGPP 108 >01_01_0876 + 6862321-6862398,6862442-6862747 Length = 127 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +1 Query: 574 GGGGGXXPP---XLXGGGXXXXSPPKXGGG 654 GGGGG PP L GGG P+ GGG Sbjct: 5 GGGGGSPPPSLSDLAGGGRGRPIWPEEGGG 34 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 23.8 bits (49), Expect(2) = 6.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -2 Query: 612 PXEXGGXXPPPPPP 571 P G PPPPPP Sbjct: 134 PYVRGATAPPPPPP 147 Score = 23.4 bits (48), Expect(2) = 6.3 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -2 Query: 588 PPPPPPXXGGGXPXF 544 PPPPPP P F Sbjct: 143 PPPPPPPMAVAPPPF 157 >09_04_0616 + 18977421-18977907,18977984-18978245,18978903-18979149 Length = 331 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +1 Query: 550 GXXPPXX---GGGGGGXXPPXLXGGGXXXXSP 636 G PP GGGGGG PP GG P Sbjct: 269 GNAPPAYRGGGGGGGGSRPPIYYNGGGGAHEP 300 >09_04_0258 - 16175258-16176069,16176111-16176414 Length = 371 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P GGG P P G PPPP G G P Sbjct: 214 PARAGGGASPPPLPVRVGA--STPPPPHGGAGLP 245 >09_02_0369 - 8012470-8013120 Length = 216 Score = 28.7 bits (61), Expect = 7.0 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -2 Query: 702 PXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P P + F PPP P PPP PP PPP Sbjct: 48 PPLKPPPQQQFITAQPPPPD---EPPLKPPPSFYPAVLPPEPPP 88 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = -2 Query: 633 GXPXXPPPXEXG--GXXPPPPPP 571 G P PPP G PPPPPP Sbjct: 183 GPPPPPPPQPSGDANENPPPPPP 205 >07_01_1143 - 10711023-10711884,10713603-10713826,10714253-10714522, 10715071-10715175 Length = 486 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 639 GGGXPXXPPPXEXGGXXPPPPPPXXG 562 G P PPP GG PP PP G Sbjct: 404 GQSYPEPPPPYYHGGQYPPYYPPYGG 429 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P PP PPPPPP P Sbjct: 59 PPPASPPLPSATPPLAASPPPPPPPPPPRNSPSP 92 >04_04_1407 - 33345230-33345372,33345492-33345626,33346559-33346904 Length = 207 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +3 Query: 561 PXXXGGGGGGFXPXTXGGGGXXXFPPQXXGGXKXXE 668 P G GGGG + GGG P+ GG + E Sbjct: 55 PELGGSGGGGAGDGSGSGGGGDSEKPRGGGGDEEGE 90 >04_04_0746 + 27726736-27727118,27727518-27727544,27728042-27728126, 27729252-27729809 Length = 350 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 634 GKXXXPPPPXVXGXXPPPPPP 572 GK PPPP + PPPPPP Sbjct: 28 GKCPTPPPPAL----PPPPPP 44 >04_03_0803 - 19835284-19836050,19836337-19836418 Length = 282 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 589 PPPPPPXXXGGXTXFFXXGXKXGGAPXXKXPXXP 488 PPPPPP GG G GG P P P Sbjct: 197 PPPPPPSRCGG-CDHADCGGWCGGQPPINCPPPP 229 >03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828, 9971146-9971935,9972002-9972051,9972618-9972704 Length = 571 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP PP + PPPPPP Sbjct: 76 PKVSPPPPQKPDKVSPPPAQKPSKVSPPPPPP 107 >02_05_0543 + 29872168-29872767,29873089-29873115 Length = 208 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 640 WGGKXXXPPPPXVXGXXPPPPPP 572 WG PPPP PPPPPP Sbjct: 175 WGESPAAPPPP------PPPPPP 191 >01_06_1731 + 39516897-39517632,39517744-39517912,39517985-39518488, 39518619-39518747,39519849-39519990,39520082-39520453 Length = 683 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 50 PPPPYQVMPVPPPPPP 65 >01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536, 7878507-7878761 Length = 223 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = -1 Query: 643 FWGGKXXXPPPPXVXGXXPPPPPPXXXGGXTXFFXXGXKXGGAP 512 F G PP P V G P PPP G ++ G P Sbjct: 31 FQGPPSYPPPRPPVVGYPQPAPPPGLYGQGDPYYRPRGGYQGIP 74 >12_02_1063 - 25769821-25770365,25770513-25771010,25771394-25771406 Length = 351 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 550 GXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGGXK 660 G P GGGG P GGG P + GGG + Sbjct: 35 GQRPGHDGGGGLRGWRPGRDGGGLRGRWPGRDGGGLR 71 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 28.3 bits (60), Expect = 9.3 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEX---GGXXPPPPPPXXGGGXPXFFXXXKRXGGPQXI 505 P PPP PPP PPPPPP P GGP+ + Sbjct: 82 PTPTPPPPSSTASSSLPPPTPLLPKHQQAPPPPPPTQSHQPPPPVAVRAPRGGPRRL 138 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P P P P P PPPPPP Sbjct: 201 PPVFPTPSPPSILPPLTPQPPPSSLIPPVLPLPLLNPPPPPPPPP 245 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPP V PPPPPP Sbjct: 257 PPPQSVRPPPPPPPPP 272 >07_03_1140 - 24258627-24258849,24259967-24260089,24260200-24260921, 24260945-24261073,24261484-24261714 Length = 475 Score = 28.3 bits (60), Expect = 9.3 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 17/48 (35%) Frame = -2 Query: 654 PPPXFGGGXPXXPP----PXEX-------------GGXXPPPPPPXXG 562 PPP GGG P P P E GG PPPPPP G Sbjct: 21 PPPSTGGGIPQLPAAAAAPVEGLLDAPFSSSSGGGGGGWPPPPPPLSG 68 >07_03_0698 - 20765305-20768526 Length = 1073 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -2 Query: 636 GGXPXXPPPXE-XGGXXPPPPPPXXGGG 556 GG PPP + GG PPP GGG Sbjct: 305 GGDKEQPPPLQSEGGDKEQPPPLQSGGG 332 >07_03_0435 + 18182657-18183509,18184477-18184574,18184663-18184833, 18185524-18185624,18185702-18185837,18186007-18186057, 18186202-18186489,18186610-18186844,18186924-18187204, 18187336-18187557 Length = 811 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGGXXXFPP 638 GGGGGG GGGG PP Sbjct: 11 GGGGGGGGGDGDGGGGGRAVPP 32 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 28.3 bits (60), Expect = 9.3 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXX----PPPPPPXXGGGXP 550 +PP P K P P G P E G PPPPPP P Sbjct: 162 APPPGKPPMYKSSIGPRIPLPSSSAGASSSMPGTEEAGPSTLPPPPPPPPLPASSEP 218 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP P P PPPPPP Sbjct: 205 PPPPPPPLPASSEPVDPSAASLPPLPPPPPPP 236 >06_01_0474 - 3362734-3362827,3363179-3363366,3363458-3363700, 3363820-3364098,3364189-3364386,3364475-3365110, 3365209-3365463,3365579-3365685,3365770-3369566, 3369677-3370166,3370918-3371308,3371481-3371573, 3371687-3371810,3372544-3372791 Length = 2380 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP G G P PPP G PP GGG P Sbjct: 5 PPPPGTGAPPPPPPAAVG------PPGGVGGGKP 32 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 619 PPPPXVXGXXPPPPP 575 PPPP + PPPPP Sbjct: 120 PPPPPIDTLPPPPPP 134 >05_01_0141 - 937428-937717,938483-938705 Length = 170 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGGXTXFFXXGXKXGGAP 512 PPPP PPPPP GG + G AP Sbjct: 40 PPPPTAY----PPPPPAGYGGGYGYPPAGYPGSSAP 71 >03_02_0850 + 11775232-11776077,11776761-11777321 Length = 468 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 558 PPXXXGGGGGGFXPXTXGGG 617 P GGGGGG P GGG Sbjct: 90 PQGGGGGGGGGVWPDVRGGG 109 >02_04_0177 + 20669053-20669055,20669150-20669198,20669680-20669962, 20670526-20670661,20671014-20671094 Length = 183 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 489 GXXGXLXXGAPPXFXPXKKKXVXPPXXXGGGGGGF 593 G G GAP F P + P GGGGGF Sbjct: 139 GDFGGEKGGAPAEFQPSFRSSGGRPGFGRGGGGGF 173 >02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242, 8812361-8812492,8812681-8812864,8813002-8813135, 8813552-8813656,8813738-8813839,8813930-8814022, 8814136-8814456,8814595-8814696,8814791-8814853, 8815213-8815708,8815964-8816124,8816213-8816743, 8817077-8817118,8817203-8817334,8817639-8817703, 8817858-8818169,8818262-8818334,8818425-8818517, 8819440-8819501,8819740-8819809 Length = 1777 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 519 PPXFXPXKKKXVXPPXXXGGGGGGFXPXTXGGGGXXXFPPQXXG 650 PP P P GGGGG GGG +PP G Sbjct: 145 PPPPPPASPDAAKTPGSPAGGGGGVGAG-GGGGEEPMYPPPKLG 187 >01_05_0490 + 22672241-22674679 Length = 812 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXG 560 PP P + PPPPPP G Sbjct: 691 PPSPPLPPPPPPPPPPMSEG 710 >01_05_0433 - 22094784-22095659 Length = 291 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 637 GGKXXXPPPPXVXGXXPPPP 578 GG PPP V G PPPP Sbjct: 36 GGGGAARPPPMVPGRVPPPP 55 >01_01_0046 - 331758-332627 Length = 289 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -2 Query: 687 PXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 P + +FP + PP P PPP PP PP Sbjct: 9 PPQRYWFPYWTSPPP---PPPPPPPPPSSSRYRPPSPP 43 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,994,258 Number of Sequences: 37544 Number of extensions: 630789 Number of successful extensions: 13630 Number of sequences better than 10.0: 131 Number of HSP's better than 10.0 without gapping: 2877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7414 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2682675460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -