BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D23 (937 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 49 6e-06 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 46 6e-05 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 43 3e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 41 0.001 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 38 0.012 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 37 0.020 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 37 0.020 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 36 0.036 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 36 0.047 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 36 0.047 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.062 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 36 0.062 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.082 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.19 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 34 0.19 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 34 0.19 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 34 0.19 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.25 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 32 0.58 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 32 0.58 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.0 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 31 1.8 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 30 3.1 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 30 3.1 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 4.1 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 29 5.4 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) 29 7.1 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -2 Query: 666 PXFXPPPXFG--GGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P PPP G GG P PPP GG PPPPPP GG P Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPP 701 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 P PPP GG P PPP GG PPPPPP GG Sbjct: 676 PPPPPPPLPGGAAPPPPPPI--GGGAPPPPPPGFGG 709 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PP P + PPP GG PPP GG PPPPP G Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGG 709 Score = 36.7 bits (81), Expect = 0.027 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 648 PXFGGGXPXXPPPXEXGGXXPPPPPPXXGGG 556 P G P PPP G PPPPPP GG Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGG 686 Score = 35.5 bits (78), Expect = 0.062 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPPXXXGG 557 PP GG PPPP G PPPPP GG Sbjct: 680 PPPLPGGAAPPPPPPI--GGGAPPPPPPGFGG 709 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 517 PPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGG 651 PP P PP GG PP GGG PP GG Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGG 709 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 207 GXXXPPPPKXGGXGAXKKKKXXGXGGPPPEKXGXKXF 317 G PPPP G A G G PPP G F Sbjct: 674 GAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGGF 710 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 559 PPXXGGGGGGXXPPXLXG--GGXXXXSPPKXGGG 654 PP GG GG PP GG PP GGG Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGG 698 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P P FGG PPP GG PPPPPP GGG P Sbjct: 645 PNPFFGG----IPPPPPGGGMFPPPPPPPPGGGVP 675 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 672 FFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 FF PPP GG P PPP GG PP PP G Sbjct: 648 FFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPPG 684 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +1 Query: 517 PPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXX-XXSPPKXGGGXKXXKK 672 PP PF G PP GGG PP GGG PP G KK Sbjct: 644 PPNPFFG----GIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPPGNLSTLNKK 692 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 298 FSGGGPPXPXXFFFFXAPXPPXLGGGGXXXP 206 F GG PP P F P PP GGG P Sbjct: 648 FFGGIPPPPPGGGMFPPPPPPPPGGGVPGPP 678 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP GG P PPP GG PPPPPP G P Sbjct: 933 PPPPPGGSAPSQPPPP--GGNAPPPPPPPGGSAPP 965 Score = 40.7 bits (91), Expect = 0.002 Identities = 28/84 (33%), Positives = 29/84 (34%) Frame = -2 Query: 822 APPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFXPPPX 643 +PP PP PP GG GG PP P P PP Sbjct: 913 SPPGGSVPPP-----PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP-PGGSAPPP 966 Query: 642 FGGGXPXXPPPXEXGGXXPPPPPP 571 GG P PPP PPPPPP Sbjct: 967 GGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP GG P PPP GG P PPP G P Sbjct: 922 PPPPPGGNAPLPPPPP--GGSAPSQPPPPGGNAPP 954 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPX----EXGGXXPPPPPPXXGGGXP 550 PPP G P PPP GG PP PPP G P Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPP 983 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P PP GG P PPP GG P PPPP GG P Sbjct: 910 PSASPP---GGSVPPPPPPP--GGNAPLPPPP-PGGSAP 942 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 669 FPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 FP P G P GG PPPPPP GG P Sbjct: 893 FPRRNESPSQTPGGSESPSASPPGGSVPPPPPP-PGGNAP 931 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP G P PPP GG PPPPPP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPP 320 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 639 GGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 GGG P PPP G PPPPP GG P Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPP 315 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -2 Query: 702 PXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEX----GGXXPPPPPP 571 P P P PPP GG P PPP GG PPPPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPPXXXGG 557 P GG PPPP G P PPPP GG Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPPGG 312 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPP-XXXGG 557 PP G PPPP G PPPPPP G Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPG 326 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PP GG P PPP GG PPPPPP G Sbjct: 355 PPPVGGAAPPPPPPPPVGGP-PPPPPPIEG 383 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXG-----GXXPPPPPPXXGGGXP 550 PPP GG P PPP E G PPPPPP G P Sbjct: 366 PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G P PPP G PPPPPP G P Sbjct: 355 PPPVGGAAPPPPPPPPVGG---PPPPPPPIEGRPP 386 Score = 35.5 bits (78), Expect = 0.062 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G P PPP G PPPPPP P Sbjct: 306 PPPPSRGSAP--PPPPARMGTAPPPPPPSRSSQRP 338 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = -2 Query: 654 PPPXFGGGXPXX----PPPXEXGGXXPPPPPPXXGGGXP 550 PPP G P PPP G PPPPP G P Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPP 327 Score = 31.9 bits (69), Expect = 0.77 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP G PPPPPP Sbjct: 316 PPPPARMGTAPPPPPP 331 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 619 PPPPXVXGXXPPPPP 575 PPPP G PPPPP Sbjct: 305 PPPPPSRGSAPPPPP 319 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPP 577 PP P PPP G PPP PPPP Sbjct: 299 PPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGG 559 PPP GG P PPP G PPPPP GG Sbjct: 197 PPPPGPGGIPPPPPPIRGG---VPPPPPMGGG 225 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 618 PPPXEXGGXXPPPPPPXXGGGXP 550 PPP G PPPPPP GG P Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPP 218 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPP 575 PP G PPPP + G PPPPP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGG 557 PPPP PPPPP GG Sbjct: 195 PPPPPPGPGGIPPPPPPIRGG 215 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 37.1 bits (82), Expect = 0.020 Identities = 29/95 (30%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = -2 Query: 819 PPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFX----- 655 PP PP F PP G +G F PP P P F Sbjct: 134 PPKNSSPPPPFGAPPPPDRGGQLAKKPSQGS---FPPPPPMGKPPPPSGNKPTFGNSRTS 190 Query: 654 ----PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PPP PPP G PPPPPP G Sbjct: 191 TNGPPPPPHSRHGSAPPPPERSSG--PPPPPPGRG 223 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 7/34 (20%) Frame = -2 Query: 654 PPPXFG---GGXPXXP----PPXEXGGXXPPPPP 574 PPP G GG P P PP + G PPPPP Sbjct: 251 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPP---PPXXGGGXPXFFXXXKRXGGP 514 P PPP GG P G PPPP PP G P F GP Sbjct: 143 PFGAPPPPDRGGQLAKKP--SQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGP 194 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P F P P P PPP PPPPPP Sbjct: 282 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPL---NATPPPPPP 323 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PPP P PPP G PPPPP Sbjct: 320 PPPPSRDQVPLPPPPLR-GQIAPPPPP 345 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXP---PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXF 544 PP P P P P GG P P G PPPPP P F Sbjct: 344 PPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSF 400 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 37.1 bits (82), Expect = 0.020 Identities = 29/95 (30%), Positives = 30/95 (31%), Gaps = 9/95 (9%) Frame = -2 Query: 819 PPTXXKNPPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPXFX----- 655 PP PP F PP G +G F PP P P F Sbjct: 46 PPKNSSPPPPFGAPPPPDRGGQLAKKPSQGS---FPPPPPMGKPPPPSGNKPTFGNSRTS 102 Query: 654 ----PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PPP PPP G PPPPPP G Sbjct: 103 TNGPPPPPHSRHGSAPPPPERSSG--PPPPPPGRG 135 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 7/34 (20%) Frame = -2 Query: 654 PPPXFG---GGXPXXP----PPXEXGGXXPPPPP 574 PPP G GG P P PP + G PPPPP Sbjct: 163 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPP---PPXXGGGXPXFFXXXKRXGGP 514 P PPP GG P G PPPP PP G P F GP Sbjct: 55 PFGAPPPPDRGGQLAKKP--SQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGP 106 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P F P P P PPP PPPPPP Sbjct: 194 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPL---NATPPPPPP 235 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPP 574 PPP P PPP G PPPPP Sbjct: 232 PPPPSRDQVPLPPPPLR-GQIAPPPPP 257 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXP---PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXF 544 PP P P P P GG P P G PPPPP P F Sbjct: 256 PPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSF 312 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 36.7 bits (81), Expect = 0.027 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXX----PPPPPPXXGGG 556 PP P F PP G P PP GG PPP PP GGG Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPPVGGGG 214 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G G PPP G PPPP GGG P Sbjct: 515 PPPGAGQGW-GQPPPGAGQGGGPPPPGAGQGGGPP 548 Score = 35.5 bits (78), Expect = 0.062 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G G P PP G PPPP GGG P Sbjct: 570 PPPGAGQGGP---PPPGAGQEGPPPPGAGQGGGPP 601 Score = 35.1 bits (77), Expect = 0.082 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 654 PPPXFG-GGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G GG P PPP G PPPP G G P Sbjct: 493 PPPGAGQGGGP--PPPGAGQGGGPPPPGAGQGWGQP 526 Score = 35.1 bits (77), Expect = 0.082 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 654 PPPXFG-GGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G GG P PPP G PPP GGG P Sbjct: 504 PPPGAGQGGGP--PPPGAGQGWGQPPPGAGQGGGPP 537 Score = 35.1 bits (77), Expect = 0.082 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 654 PPPXFG-GGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G GG P PPP G PPPP G G P Sbjct: 526 PPPGAGQGGGP--PPPGAGQGGGPPPPGAGQGWGQP 559 Score = 35.1 bits (77), Expect = 0.082 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 654 PPPXFG-GGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G GG P PPP G PPP GGG P Sbjct: 537 PPPGAGQGGGP--PPPGAGQGWGQPPPGAGQGGGPP 570 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP G G PPP G PPPP G G P Sbjct: 579 PPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLP 612 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G G PPP G PPPP GG P Sbjct: 548 PPPGAGQGW-GQPPPGAGQGGGPPPPGAGQGGPPP 581 Score = 32.3 bits (70), Expect = 0.58 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 639 GGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 GG PPP G PPPP GGG P Sbjct: 486 GGQGWGQPPPGAGQGGGPPPPGAGQGGGPP 515 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 9/44 (20%) Frame = -2 Query: 654 PPPXFG-GGXPXXPPPXEXGGXXPP-------PPPPXXG-GGXP 550 PPP G GG P PPP G PP PPPP G GG P Sbjct: 559 PPPGAGQGGGP--PPPGAGQGGPPPPGAGQEGPPPPGAGQGGGP 600 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 GPP P + G PP G GGG P GGG PP G G Sbjct: 513 GPPPP-GAGQGWGQPPPGAGQGGGPPPPGAGQGGG-----PPPPGAG 553 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 GPP P + G PP G G G PP GG PP G G Sbjct: 502 GPPPP--GAGQGGGPPPPGAGQGWGQPPPGAGQGG----GPPPPGAG 542 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP G G PPP G PPP GG P Sbjct: 503 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGP 536 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 GPP P + G PP G G G PP GG PP G G Sbjct: 535 GPPPP--GAGQGGGPPPPGAGQGWGQPPPGAGQGG----GPPPPGAG 575 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP G G PPP G PPP GG P Sbjct: 536 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGP 569 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGG----GXXXXSPPKXGGG 654 GPP P + G PP G GGG P GG G PP G G Sbjct: 546 GPPPP-GAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAG 595 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 550 GXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGGG 654 G PP G G GG PP G G PP G G Sbjct: 566 GGGPPPPGAGQGGPPPP---GAGQEGPPPPGAGQG 597 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 639 GGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 GGG PP G PPPP GG P Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGP 514 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGG 651 G P P + G PP G GGG PP G G PP G Sbjct: 491 GQPPP--GAGQGGGPPPPGAGQGGGPPPP---GAGQGWGQPPPGAG 531 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 514 GPPXPFXXXKKXGXXPPXXGGGGGGXXPPXLXGGGXXXXSPPKXGG 651 G P P + G PP G GGG PP G G PP G Sbjct: 524 GQPPP--GAGQGGGPPPPGAGQGGGPPPP---GAGQGWGQPPPGAG 564 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 36.3 bits (80), Expect = 0.036 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFFXXXK 529 P PPP F GG P PPP G PPPP GG P + K Sbjct: 198 PPPPPPPGFPGGAPPPPPPP--FG---APPPPALNGGPPREYCDVK 238 Score = 35.1 bits (77), Expect = 0.082 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXG--GXXPPPPPPXXGGGXP 550 P G P PPP G G PPPPPP G P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 304 PXFSGGGPPXPXXFFFFXAPXPPXLGGG 221 P F GG PP P F AP PP L GG Sbjct: 204 PGFPGGAPPPPPPPF--GAPPPPALNGG 229 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P P G P PPP PPPPP G P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 35.9 bits (79), Expect = 0.047 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 6/58 (10%) Frame = -2 Query: 705 PPXXXXPXXKXFFPX---FXPPPXFGGGXPXXPPPXEXG--GXXPPPPPPXXG-GGXP 550 PP P P PPP G P PP + G G PPPPPP G G P Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLP 754 Score = 35.1 bits (77), Expect = 0.082 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFG-GGXPXXPPPXEXG-GXXPPPPPPXXGGGXPXFF 541 PP P P P P G G P PPP G PPPPPP P F+ Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKPLFW 769 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP + G P PPPP Sbjct: 700 PPPPLLSGTLPMPPPP 715 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 35.9 bits (79), Expect = 0.047 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXF 544 P PP GG P PP G PPPPPP G G P + Sbjct: 204 PGMWGPPPMGGPPPMGGPP----GGYPPPPPP-PGAGDPAY 239 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 666 PXFXPPPXFG--GGXPXXPPPXEXGGXXPPPPPP 571 P PPP G GG P PPP G P PPP Sbjct: 211 PMGGPPPMGGPPGGYPPPPPPP--GAGDPAYPPP 242 Score = 28.3 bits (60), Expect = 9.4 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = -2 Query: 702 PXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPP---PPPXXG--GGXP 550 P P + +P P G G P P + G PPP PPP G GG P Sbjct: 171 PGQSYPQGQEPYPEKGGYPPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYP 226 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 35.5 bits (78), Expect = 0.062 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXG---XXPPPPPPXXXGG 557 PP F G PPPP + PPPPPP GG Sbjct: 292 PPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGG 326 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFFXXXKRXGGPQ 511 PPP GG P PP PPPPP G P GGP+ Sbjct: 283 PPPLTGGMLP--PPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGPK 328 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 35.5 bits (78), Expect = 0.062 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 35.1 bits (77), Expect = 0.082 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 35.1 bits (77), Expect = 0.082 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P + P PPP P PPP PPPPPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P P PPP P PP PPPPPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P P PPP P PPP PPPPPP Sbjct: 388 SPPPPPQPPPPP--PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 32.3 bits (70), Expect = 0.58 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P P PPP P PPP PP PPP Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP P PPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP PPP PPPPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P PPP P PPP PPPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP---PPPPPPP 432 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.1 bits (77), Expect = 0.082 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 717 FFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 F S P P P PPP P PPP PPPPPP Sbjct: 45 FISSSPPPPPPSPPAAAPAAPPPP---AAAPAAPPPPAAPPAAPPPPPP 90 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP P PPP G PPPPPP G P Sbjct: 365 PPPPPPTNKPPPPPPPTNG---PPPPPPPTNGPPP 396 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PPP G P PPP PPPPPP G P Sbjct: 376 PPPPPTNGPPPPPPPTNG---PPPPPPPTNGPPPP 407 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PPP G P PPP PPPPPP G Sbjct: 386 PPPPPTNGPPPPPPPT---NGPPPPPPPTNG 413 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P PPP P PPP PPPPPP G P Sbjct: 354 PPSPPPPT--NNTPPPPPPTN----KPPPPPPPTNGPPP 386 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXG 560 PPPP PPPPPP G Sbjct: 374 PPPPPPPTNGPPPPPPPTNG 393 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXG 560 PPPP PPPPPP G Sbjct: 384 PPPPPPPTNGPPPPPPPTNG 403 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXG 560 PPPP PPPPPP G Sbjct: 394 PPPPPPPTNGPPPPPPPTNG 413 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 346 PPPPPTNNPPSPPPPT---NNTPPPPPP 370 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGGXTXFFXXGXKXGGA 515 PPPP G PPPPP G G K GA Sbjct: 396 PPPPPTNG---PPPPPPPTNGPPSEGKCGRKPAGA 427 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.9 bits (74), Expect = 0.19 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 7/56 (12%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPP--PXFGG-GXPXXPPPXEXGGXXP----PPPPPXXGG 559 PP P P F P P GG P PPP GG P PPPPP G Sbjct: 248 PPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPSSG 303 Score = 31.9 bits (69), Expect = 0.77 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXG-GXXPPP--PPPXXGGGXP 550 PP P P PPP P PP G G PPP PPP GG P Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMP-PPGFPPMGMPGMGGMPPPGMPPPMPPGGMP 289 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 33.9 bits (74), Expect = 0.19 Identities = 28/86 (32%), Positives = 32/86 (37%), Gaps = 3/86 (3%) Frame = -2 Query: 798 PPXFFXXPPGGGGXXFFYXXXKGGXVFFFXSPPXXXXPXXKXFFPX---FXPPPXFGGGX 628 PP + PP GG Y +GG + P P P + PPP GG Sbjct: 192 PPGGYQQPPPGGYAPPPYVPQEGGGI------PPQNHPLTNYPAPPPQGYAPPP---GGY 242 Query: 627 PXXPPPXEXGGXXPPPPPPXXGGGXP 550 P PP GG PPP GG P Sbjct: 243 PGAPPA---GGYPGAPPPGGYPGGPP 265 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 660 FXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 + PPP GG PP GG PPP P GGG P Sbjct: 189 YYPPP---GGYQQPPP----GGYAPPPYVPQEGGGIP 218 Score = 29.1 bits (62), Expect = 5.4 Identities = 21/69 (30%), Positives = 27/69 (39%), Gaps = 5/69 (7%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPP-----PPPXXGGGXPXFF 541 PP P + +P + PP P P + GG PPP PPP GG P + Sbjct: 157 PPPGTQPPGQGGYPGYNQPPP-----GHYPAPGQPGGYYPPPGGYQQPPP--GGYAPPPY 209 Query: 540 XXXKRXGGP 514 + G P Sbjct: 210 VPQEGGGIP 218 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 660 FXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 F PPP PPP E PPPPPP Sbjct: 299 FQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 32.3 bits (70), Expect = 0.58 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 649 PXFWGGKXXXPPPPXVXGXXPPPPPP 572 P + PPPP PPPPPP Sbjct: 291 PGMFASSGFQPPPPPPTDFAPPPPPP 316 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 P PPP GG P PP GG PPP GG P Sbjct: 589 PGTYPPPHPSGGYPQPSPP--HGGHPHHPPPTGYPGGYP 625 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P + P PP G P PPP PPPPPP Sbjct: 127 PPPPTSPATRA--PPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG---GGXP 550 PP P P PPP PPP PPPPP GG P Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPP 165 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPXVXGXXPPPPPP 572 PP GG PPPP PPPPPP Sbjct: 188 PPPPSGGPPPPPPPPP-----PPPPPP 209 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -2 Query: 618 PPPXEXGGXXPPPPPP 571 PPP G PPPPPP Sbjct: 188 PPPPSGGPPPPPPPPP 203 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = -2 Query: 618 PPPXEXGGXXPPPPPP--XXGGGXPXFFXXXKRXGGP 514 PPP PPPPPP GG P GGP Sbjct: 128 PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGP 164 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP GG P PPP PPPPPP Sbjct: 188 PPPPSGG--PPPPPP-------PPPPPP 206 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP P PPP PPPPPP Sbjct: 207 PPPRPPP---SPPPPPPPPSPSPPRPPPPPPP 235 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PP PPP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPP 231 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P P + PPP P PPP PPPP P Sbjct: 196 PPPPNAPNPPPPNPPYPPPPN-APNPPYPPPPNAPNPPYPPPPNP 239 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPP-PXEXGGXXPPPPPPXXGGGXP 550 PP P P + PPP P PP P PP PPP P Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = -2 Query: 717 FFXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 F +PP P +P + PPP + P P P PPPP P Sbjct: 88 FSPNPPYPPPP-----YPPYPPPPPY-PPPPNPPYPPPPNAPYPPPPNP 130 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP F P PPP PP PPP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPP 111 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P +P PP P P P PPPP P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP P + P PPP P PP P PPPP Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -2 Query: 714 FXSPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 + PP P P PPP P PPP PP PP Sbjct: 148 YPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPP 194 Score = 28.3 bits (60), Expect = 9.4 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 +PP P +P PP P PPP PP PP Sbjct: 166 NPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 32.3 bits (70), Expect = 0.58 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 651 PPXFGGGXPXXPPPX-EXGGXXPPPPPP 571 PP G G PPP + GG P PPPP Sbjct: 376 PPGAGNGPGGPPPPWSKPGGILPGPPPP 403 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 550 GXXPPXXGGGGGGXXPPXLXGGGXXXXSPP 639 G PP G G GG PP GG PP Sbjct: 373 GMRPPGAGNGPGGPPPPWSKPGGILPGPPP 402 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 426 PPPPGFPQFQPPPPPP 441 >SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) Length = 695 Score = 32.3 bits (70), Expect = 0.58 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 615 PPXEXGGXXPPPPPPXXGGGXPXFFXXXKRXGGP 514 PP GG PP PP GGG P F R G P Sbjct: 463 PPKRGGG---PPLPPKRGGGPPLFGAMALRTGAP 493 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 32.3 bits (70), Expect = 0.58 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP P PP PPPPPP Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPP 316 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 31.9 bits (69), Expect = 0.77 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 639 GGGXPXXPPPXEXGGXXPPPPPP 571 GGG P P G PPPPPP Sbjct: 164 GGGEGPNPSPPPSGAPPPPPPPP 186 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPP--PPXXGGGXP 550 PPP P PPP + PPPP PP G P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 683 PPPPPPPPPPPPPPPP 698 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -1 Query: 634 GKXXXPPPPXVXGXXPPPPPP 572 G+ PPPP PPPPPP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPP 481 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 634 GKXXXPPPPXVXGXXPPPPPP 572 G PPPP PPPPPP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPP 479 Score = 29.1 bits (62), Expect = 5.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 639 GGGXPXXPPPXEXGGXXPPPPPP 571 G P PPP PPPPPP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPP 483 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPP 574 P PPP P PPP PPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 P PPP P PPP PPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGGXT 551 PPPP PPPPPP G T Sbjct: 870 PPPPPPPPPPPPPPPPASSTGST 892 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGGXTXFFXXGXK 527 PPPP PPPPPP T G K Sbjct: 867 PPPPPPPPPPPPPPPPPPPASSTGSTPGGDK 897 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPPXXGGG 556 P PPP PPPPPP G Sbjct: 867 PPPPPPPPPPPPPPPPPPPASSTG 890 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 31.1 bits (67), Expect = 1.3 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP + PPPPPP Sbjct: 94 PPPPQLENDFPPPPPP 109 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXG 562 PP P + P P P PPP PPPPPP G Sbjct: 27 PPPPTRPFERNIHPRTEPRDR--ERPPPPPPPRFYDNDIPPPPPPRRG 72 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = -1 Query: 652 PPXFWGGKXXXPPPPX---VXGXXPPPPPP 572 PP F+ PPPP PPPPPP Sbjct: 55 PPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 29.1 bits (62), Expect = 5.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -2 Query: 666 PXFXPPPXF-GGGXPXXPPPXE-XGGXXPPPPPP 571 P PPP F P PPP PPPPPP Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPP 83 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 740 PPPPATAAKAPPPPPP 755 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 233 PPPPPAAAPPPPPPPP 248 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 225 PPPP---AAPAPPPPPAAAPPPPPPPPP 249 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP G P PPP G PPPP P Sbjct: 189 PPPAPPGVLP--PPPAPPGALIPPPPAP 214 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -2 Query: 651 PPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PP +G G PPP G PP PP Sbjct: 265 PPQYGPGRRDMPPPGAPPGMLPPGMPP 291 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPP---PPP 571 PP P + F P PPP F P P G PPP PPP Sbjct: 284 PPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQG--RPPPFVRPPP 329 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP G P PP E PPPP P Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPP Sbjct: 564 PPPLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 424 PPPPPPPAPLPPPPPP 439 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 425 PPPPPPAPLPPPPPPP 440 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 426 PPPPPAPLPPPPPPPP 441 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP P PPP PPPPPP Sbjct: 1158 PPPP----PPPPPPPSSPSPPPPPPPPP 1181 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 1163 PPPPPPSSPSPPPPPP 1178 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 1165 PPPPSSPSPPPPPPPP 1180 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -2 Query: 627 PXXPPPXEXGGXXPPPPPPXXGGGXPXFFXXXKRXGGPQ 511 P PPP E PPPPP G P F + GP+ Sbjct: 29 PPPPPPYE----APPPPPGPPGPDGPPGFPGPQGPNGPK 63 Score = 28.3 bits (60), Expect = 9.4 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPPXXXGGXTXFFXXGXKXG--GAPXXKXPXXP 488 PPPP PPPP P G F G G P P P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGP 74 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXPXFFXXXKRXGGPQ 511 P PPP GG P PP P P PP G G GGP+ Sbjct: 219 PGMLPPP--GGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPPHGQMHMGGPR 268 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 573 GGGGGGFXPXTXGGGG 620 GGGGGGF + GGGG Sbjct: 124 GGGGGGFYQDSYGGGG 139 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = -2 Query: 627 PXXPPPXEXG-GXXPPPPPP 571 P PPP G G PPPPPP Sbjct: 756 PPPPPPAVPGEGARPPPPPP 775 Score = 26.6 bits (56), Expect(2) = 4.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 11/46 (23%) Frame = -2 Query: 666 PXFXPPPXFGGGXP---------XXPPPXE--XGGXXPPPPPPXXG 562 P PPP GGG P PP G P PPPP G Sbjct: 686 PPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLG 731 Score = 21.0 bits (42), Expect(2) = 4.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 588 PPPPPPXXGGG 556 PPPPP G G Sbjct: 757 PPPPPAVPGEG 767 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 54 PPPPPPPPPPPPPPPP 69 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 55 PPPPPPPPPPPPPPPP 70 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 56 PPPPPPPPPPPPPPPP 71 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 102 PPPPPPPPPPPPPPPP 117 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 103 PPPPPPPPPPPPPPPP 118 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 104 PPPPPPPPPPPPPPPP 119 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 105 PPPPPPPPPPPPPPPP 120 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP V PP PPP Sbjct: 795 PPPPRVMNGLPPSPPP 810 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 619 PPPPXVXGXXPPPPPP 572 PPPP PPPPPP Sbjct: 87 PPPPASNVPAPPPPPP 102 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/30 (40%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = -2 Query: 654 PPPXFG---GGXPXXPPPXEXGGXXPPPPP 574 PPP F P PPP + PPPP Sbjct: 570 PPPEFSDLESSAPIPPPPPQMNNTSAPPPP 599 >SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2391 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 511 LGPPXPFXXXKKXGXXPPXXGGGGGGXXPP 600 L PP + +K G PP GGGGGG P Sbjct: 1242 LRPPDSWRG-QKGGSSPPLGGGGGGGAQLP 1270 >SB_42044| Best HMM Match : ubiquitin (HMM E-Value=1.2e-06) Length = 1425 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = -2 Query: 666 PXFXPPPXFGGGXPXXPPPXEXG-GXXPPPPPP 571 P PPP + P PPP G P PPP Sbjct: 132 PVPDPPPKYSTSAPVQPPPAPTPVGSTPSDPPP 164 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = -2 Query: 705 PPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPPXXGGGXP 550 PP P + F PPP FG P P G PPP G P Sbjct: 471 PPMGMYPPPRGF-----PPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 708 SPPXXXXPXXKXFFPXFXPPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 SPP P P PPP P PPP PPP P Sbjct: 1048 SPPPSAVPIPPPRKPS--PPPSEPAPPPRQPPPPSTSQPVPPPRQP 1091 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 28.3 bits (60), Expect = 9.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 654 PPPXFGGGXPXXPPPXEXGGXXPPPPPP 571 PPP G P P G PPPP P Sbjct: 154 PPPQTTMGYPSAQPGFAPPGNYPPPPAP 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,043,204 Number of Sequences: 59808 Number of extensions: 311831 Number of successful extensions: 4100 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2028 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2729039029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -