BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D17 (872 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19611| Best HMM Match : No HMM Matches (HMM E-Value=.) 194 6e-50 SB_20269| Best HMM Match : SOCS_box (HMM E-Value=4.6e-05) 29 5.0 SB_58015| Best HMM Match : rve (HMM E-Value=0.00087) 28 8.7 SB_45852| Best HMM Match : I-set (HMM E-Value=0) 28 8.7 SB_34554| Best HMM Match : RVT_1 (HMM E-Value=0.2) 28 8.7 SB_32309| Best HMM Match : C1_3 (HMM E-Value=7.3) 28 8.7 SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_22517| Best HMM Match : UPF0081 (HMM E-Value=1) 28 8.7 >SB_19611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 194 bits (474), Expect = 6e-50 Identities = 90/106 (84%), Positives = 100/106 (94%) Frame = +2 Query: 179 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITV 358 MPPKFDPNEI+ V LRC GGEVGAT+SLAPKIGPLGLSPKKVGDDIAKAT DWKGLKITV Sbjct: 1 MPPKFDPNEIQYVYLRCTGGEVGATASLAPKIGPLGLSPKKVGDDIAKATQDWKGLKITV 60 Query: 359 QLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISL 496 LT+QNRQA+++VVPSA++LII+ALKEPPRDRKK KNIKHNGNI+L Sbjct: 61 CLTIQNRQAKVSVVPSASSLIIKALKEPPRDRKKVKNIKHNGNITL 106 Score = 88.6 bits (210), Expect = 6e-18 Identities = 40/59 (67%), Positives = 49/59 (83%) Frame = +3 Query: 495 LXDVIGIAKIMRNRSMARYLSGSVKEILGTAQSVGCTVEGRPPHDLIDDINSGALTIDE 671 L DV +AK+MR RSMAR+LSG+VKEILGT QSVGCTV+G PHD+ID INSG + I++ Sbjct: 106 LDDVTNVAKVMRPRSMARHLSGTVKEILGTCQSVGCTVDGMAPHDVIDKINSGEIEIED 164 >SB_20269| Best HMM Match : SOCS_box (HMM E-Value=4.6e-05) Length = 302 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 347 KITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKH 478 ++ ++ RQ + +PSA IR +E PR +K N+KH Sbjct: 97 RVIIRAVGSRRQVEPLPLPSALKEWIREYEEEPRFDRKLTNLKH 140 >SB_58015| Best HMM Match : rve (HMM E-Value=0.00087) Length = 1333 Score = 28.3 bits (60), Expect = 8.7 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = +2 Query: 488 ISLXRCNRHCEDHEKQINGP----VPFWLSKRDSWHSTVSWMYCGGQA 619 I RC RH + H +IN + +W +SW+ SW+Y G +A Sbjct: 978 IDQLRCFRH-DRHPIRINNETRRDLVWWQQFLESWNGVSSWLYPGLEA 1024 >SB_45852| Best HMM Match : I-set (HMM E-Value=0) Length = 1122 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 507 IGIAKIMRNRSMARYLSGS-VKEILGTAQSVGCTVEGRPP 623 +G K++++R G V+ + GT S+ C VEG PP Sbjct: 128 VGTHKLLKSRDPVIVTIGDKVETLTGTEVSIICPVEGLPP 167 >SB_34554| Best HMM Match : RVT_1 (HMM E-Value=0.2) Length = 671 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +2 Query: 251 TSSLAP-KIGPLGLSPKKVGDD--IAKATSDWKGLKITVQLTVQNRQAQIAVVPSAAALI 421 T L P ++ PLGL PKK+ D ++ S KGL + +++++ + A + A + I Sbjct: 369 TPPLVPFRVSPLGLVPKKLPGDFRLSHHLSYPKGLSVNDGISLEHSTVRYATIGDAISKI 428 >SB_32309| Best HMM Match : C1_3 (HMM E-Value=7.3) Length = 193 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 582 TAQSVGCTVEGRPPHDLIDDINSG 653 T + C VE PPH++ D +N G Sbjct: 150 TLNQLYCPVEPNPPHNMFDHVNLG 173 >SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1569 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = -2 Query: 454 TVTRRLLKGSDDKGCC-----RGNNSYLGLSVLNCQLHSDLETLPVTCGLGNVITH 302 +++ + GSD+K CC G + LG+ + +HSD++ P+ L + H Sbjct: 108 SLSSSMFTGSDNKLCCFFLGQDGEKAMLGIVYVLTHVHSDIQFCPLLPVLAALFLH 163 >SB_22517| Best HMM Match : UPF0081 (HMM E-Value=1) Length = 2568 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/56 (26%), Positives = 23/56 (41%) Frame = +2 Query: 239 EVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITVQLTVQNRQAQIAVVPS 406 E+G T + + LG PK V +D +DW + + IA+ PS Sbjct: 1793 ELGITDAEGNYVDSLGADPKAVSNDYVGYATDWVNNNLPENAITNSTWTGIALGPS 1848 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,198,846 Number of Sequences: 59808 Number of extensions: 443119 Number of successful extensions: 1052 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1011 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1052 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2503194881 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -