BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D10 (895 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) 78 1e-14 SB_47767| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) 28 8.9 >SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) Length = 112 Score = 77.8 bits (183), Expect = 1e-14 Identities = 45/115 (39%), Positives = 61/115 (53%), Gaps = 1/115 (0%) Frame = +2 Query: 524 PFAFNSCPLRRIPQRYVICTSTRISLGNFKLPKH-FNDDYFXXXXXXXXXXXXXXEGDDI 700 PF N PLRRIPQ YVI TST I + + KLP+H F D+ + +D+ Sbjct: 2 PFKINGVPLRRIPQSYVIATSTHIDVSDVKLPEHAFADESY-----FKGEPKKKKRSEDM 56 Query: 701 FATKKEKYVPSEQRKTDQKTVDEAVIKAIGARPDKKVLRGXLKAGFGLXSXQYPH 865 F E+ PSEQR DQK VD+ ++ I A P+ ++ L + F L Q+PH Sbjct: 57 FEEAAEEKKPSEQRIADQKAVDDQILPKISAVPN---MKKYLSSLFSLRKGQFPH 108 >SB_47767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 545 PLRRIPQRYVICTSTR 592 PLRR P RY IC TR Sbjct: 29 PLRRTPDRYAICDDTR 44 >SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +1 Query: 307 NQNSTPQ---T*EVLLPHSGENPCLIWWPSIQQACTQDPTQP 423 NQ++ PQ T VL+PH G PC+ +P+ TQP Sbjct: 94 NQSTLPQGNATQWVLIPHKGSMPCIGTFPNAINTWIIPGTQP 135 >SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2235 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 545 PLRRIPQRYVICTSTR 592 PLRR P RY IC TR Sbjct: 33 PLRRTPDRYAICDDTR 48 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 545 PLRRIPQRYVICTSTR 592 PLRR P RY IC TR Sbjct: 106 PLRRTPDRYAICDDTR 121 >SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) Length = 407 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 719 KYVPSEQRKTDQKTVDEAVIKAIGARPDKKVLRGXLKAG 835 + VP E+ + + K ++E VIK I A+ + V R L+ G Sbjct: 303 RLVPKERLEREPKVMEEPVIKEIAAKHNCSVARVLLRWG 341 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,310,156 Number of Sequences: 59808 Number of extensions: 557629 Number of successful extensions: 1483 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1478 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2562198215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -