BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D09 (931 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0438 + 3110703-3111945,3112486-3113057 29 7.0 10_08_0940 - 21708557-21708733,21709058-21709142,21709330-217095... 28 9.2 06_03_0833 - 25196091-25196372,25196464-25196565,25196640-251968... 28 9.2 >06_01_0438 + 3110703-3111945,3112486-3113057 Length = 604 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 151 HCILVVVCPNSSMYLIMSGSN*PSXKGRSAAAVP 50 HC + +VC +S+ L++S P+ ++AA+P Sbjct: 64 HCFVEIVCADSAGRLLLSAKPRPAPAATTSAALP 97 >10_08_0940 - 21708557-21708733,21709058-21709142,21709330-21709551, 21710640-21710815,21711883-21711946,21712433-21712507, 21715114-21715199,21715297-21716715 Length = 767 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +2 Query: 296 NESAN---ARGEAVCVLGALPLPRSLTRCAR 379 +ESAN AR EAV +G +P+ L RC+R Sbjct: 434 DESANVDAARSEAVMRVGGIPMLLDLARCSR 464 >06_03_0833 - 25196091-25196372,25196464-25196565,25196640-25196838, 25196978-25197278,25197471-25197645,25197842-25198012, 25198207-25198239 Length = 420 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +3 Query: 516 CWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLF 656 CWR + T D Q + +KD P + PSC L+F Sbjct: 283 CWRHFLNQDFAMFATAGDDQWNPEDHLPSFKDDSLIPYDVPSCHLIF 329 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,809,681 Number of Sequences: 37544 Number of extensions: 378324 Number of successful extensions: 1047 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1047 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2659245980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -