BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D07 (895 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_16224| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_50661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 273 GLGRGNTKNRLWGHRDNNLSGCSFRVSTRHW*SRQIHSHRT 395 G R +TK ++GHR+N++ F W S++++ T Sbjct: 19 GYRRSSTKATIFGHRNNSIMATIFESRNHLWISKELYKAAT 59 >SB_16224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1127 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 256 FYMELKVWVEGIQRIVCGVTETTTCQD 336 +Y+ K+ +E ++ I+C V ETT D Sbjct: 338 WYVRAKISLEALEAIICSVQETTYAMD 364 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,734,491 Number of Sequences: 59808 Number of extensions: 434872 Number of successful extensions: 817 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2562198215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -