Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fdpeP01_F_D07
         (895 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g56000.1 68416.m06222 glycosyl transferase family 2 protein s...    29   5.5  

>At3g56000.1 68416.m06222 glycosyl transferase family 2 protein
           similar to beta-(1-3)-glucosyl transferase GB:AAC62210
           GI:3687658 from [Bradyrhizobium japonicum], cellulose
           synthase from Agrobacterium tumeficiens [gi:710492] and
           Agrobacterium radiobacter [gi:710493]; contains Pfam
           glycosyl transferase, group 2 family protein domain
           PF00535
          Length = 535

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 10/33 (30%), Positives = 17/33 (51%)
 Frame = -1

Query: 523 ASSCCLVQISSI*IEYHLSILPTSSKSSVGILG 425
           A  CC+ +I  + + YH ++   S  S +G  G
Sbjct: 228 ADECCMTRIQEMSLNYHFAVEQKSGSSILGFFG 260


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,670,752
Number of Sequences: 28952
Number of extensions: 317618
Number of successful extensions: 668
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 665
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 668
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2100696768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)