BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D06 (890 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0833 - 25196091-25196372,25196464-25196565,25196640-251968... 31 1.6 10_08_0911 - 21499196-21499236,21499368-21499488,21499665-214997... 30 2.8 08_01_0156 - 1233431-1233925 29 6.6 01_07_0177 - 41776168-41776314,41776395-41776456,41777029-417771... 29 6.6 10_08_0940 - 21708557-21708733,21709058-21709142,21709330-217095... 28 8.7 06_03_0218 + 18219956-18220555 28 8.7 03_06_0149 - 31987183-31987630,31987813-31987874 28 8.7 03_04_0061 - 16949038-16950006 28 8.7 >06_03_0833 - 25196091-25196372,25196464-25196565,25196640-25196838, 25196978-25197278,25197471-25197645,25197842-25198012, 25198207-25198239 Length = 420 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/53 (30%), Positives = 21/53 (39%) Frame = +3 Query: 516 CWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLP 674 CWR + T D Q + +KD P + PSC L+F P P Sbjct: 283 CWRHFLNQDFAMFATAGDDQWNPEDHLPSFKDDSLIPYDVPSCHLIFIPLLQP 335 >10_08_0911 - 21499196-21499236,21499368-21499488,21499665-21499789, 21500187-21500418,21500488-21500668,21501342-21501438, 21501641-21501779,21502024-21502351,21502890-21503137, 21503270-21503543,21504200-21504291,21504451-21504521, 21505091-21505181,21506526-21507380,21507482-21507594, 21508007-21508074,21508655-21508835,21509084-21509186, 21509273-21509379,21510046-21511584,21511661-21511771, 21511856-21511908,21511988-21512063,21512147-21512366, 21512477-21512901,21513193-21513372,21513503-21515474 Length = 2680 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 848 TGXTQDDSYPIRRSGRLNRGVRAHSPAWSERPTP 747 T +D S+ LN +AH+PAWS P P Sbjct: 819 THTAEDKSFSFEVGAPLNITEKAHAPAWSPLPRP 852 >08_01_0156 - 1233431-1233925 Length = 164 Score = 28.7 bits (61), Expect = 6.6 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Frame = -2 Query: 769 LGANDLHRTEIPTA*AMRKRHASRREK--GGQVSGKRQGRNRRAHEGASRGKRLVSL*SC 596 LG D TE+ A A A+R E+ GG G R G RA + +G + Sbjct: 89 LGDADATATEVDAAAAAEAEAAARGERGDGGGDGGGRAGGRGRARDEREKGAAADRVLGV 148 Query: 595 RVSPPLT 575 R SP ++ Sbjct: 149 RASPTVS 155 >01_07_0177 - 41776168-41776314,41776395-41776456,41777029-41777191, 41777278-41777375,41777911-41777992,41778391-41778512, 41778645-41778722,41778873-41779026,41779629-41779767, 41780453-41780820 Length = 470 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 756 SFAPSWAVCTNPPVQPTAAPYRVTIVLS 839 S P WA+ PP +P+ AP++ LS Sbjct: 443 SQTPKWAIDALPPAKPSKAPFKQETFLS 470 >10_08_0940 - 21708557-21708733,21709058-21709142,21709330-21709551, 21710640-21710815,21711883-21711946,21712433-21712507, 21715114-21715199,21715297-21716715 Length = 767 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +2 Query: 296 NESAN---ARGEAVCVLGALPLPRSLTRCAR 379 +ESAN AR EAV +G +P+ L RC+R Sbjct: 434 DESANVDAARSEAVMRVGGIPMLLDLARCSR 464 >06_03_0218 + 18219956-18220555 Length = 199 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -2 Query: 703 SRREKGGQVSG--KRQGRNRRAHEGASRGKRLVS 608 +RRE+ + +G KR+GR R G RGKR S Sbjct: 106 ARRERRLEAAGAEKREGRRRGGSSGGLRGKRRAS 139 >03_06_0149 - 31987183-31987630,31987813-31987874 Length = 169 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 724 AMRKRHASRREKGGQVSGKRQGRNRRAHEGASRG 623 A+ + H R + + +R+GR R AHEG G Sbjct: 76 AVARGHGLERLQEAGIEAERRGRRRNAHEGIKIG 109 >03_04_0061 - 16949038-16950006 Length = 322 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 598 RTIKIPGVSPWKLPRALSCSDPAAYRIPVRLSPFGKRGA 714 RT+K PG+ ++PRA+ + P Y VR + +R A Sbjct: 255 RTMKGPGLGGARVPRAVFRASPRRYYAAVRTARKARRSA 293 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,370,573 Number of Sequences: 37544 Number of extensions: 579221 Number of successful extensions: 1809 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1809 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2506954360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -